PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_56951_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 108aa MW: 12325.8 Da PI: 10.1681 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 78.7 | 1.8e-24 | 52 | 92 | 123 | 163 |
YABBY 123 qrvPsaynrfikeeiqrikasnPdishreafsaaaknWahf 163 r Psaynrf+keeiqrika+nP+i hreafsaaaknWa + cra_locus_56951_iso_1_len_414_ver_3 52 HRLPSAYNRFMKEEIQRIKAENPEIPHREAFSAAAKNWARY 92 69*************************************76 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.7E-24 | 51 | 92 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.31E-7 | 51 | 90 | IPR009071 | High mobility group box domain |
CDD | cd01390 | 5.49E-7 | 53 | 89 | No hit | No description |
Gene3D | G3DSA:1.10.30.10 | 2.1E-5 | 55 | 91 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 108 aa Download sequence Send to blast |
XAGGTLCVLL LQQKKTPWIW FNLQNIFATF VATFAXXXXX XXXXXXXXXX XHRLPSAYNR 60 FMKEEIQRIK AENPEIPHRE AFSAAAKNWA RYIPNGAPNG SLSESTNN |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016453705.1 | 5e-30 | PREDICTED: protein CRABS CLAW-like | ||||
TrEMBL | A0A068FKR1 | 5e-29 | A0A068FKR1_9SOLN; CRC protein | ||||
TrEMBL | A0A068FN06 | 5e-29 | A0A068FN06_SOLTO; CRC protein | ||||
STRING | XP_009627054.1 | 2e-29 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA5210 | 23 | 39 |