PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_56471_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 187aa MW: 21211.4 Da PI: 8.4878 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 37.8 | 4.1e-12 | 8 | 65 | 4 | 61 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 ++ +rk +NRe+ArrsR RK+++++eL ++ ++++eNk+L ++ ++++ + + cra_locus_56471_iso_1_len_580_ver_3 8 ERKRKRKLSNRESARRSRMRKQQRLDELITEENQMKEENKKLGHMIDGATQLYLNFAT 65 57889*************************************9999998888776655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 8.3E-10 | 2 | 51 | No hit | No description |
SMART | SM00338 | 3.5E-16 | 5 | 69 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.53 | 7 | 49 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 1.3E-8 | 9 | 56 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 4.57E-10 | 9 | 61 | No hit | No description |
CDD | cd14702 | 1.43E-19 | 10 | 60 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 12 | 27 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 187 aa Download sequence Send to blast |
SPGSDNDERK RKRKLSNRES ARRSRMRKQQ RLDELITEEN QMKEENKKLG HMIDGATQLY 60 LNFATENNVL RAQMAELTDR LRSLNSVLQI ASEVSGLVFD IQDIPDTFPE PWQLPCPIQP 120 IPASVDAFQH XAMMARILIV GALPWFPMVG LNMLLLLMVL KGKPAPRHAA YATPIDGISL 180 FMLSCCY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 7 | 14 | ERKRKRKL |
2 | 8 | 13 | RKRKRK |
3 | 21 | 28 | RRSRMRKQ |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds DNA to the C-box-like motif (5'-TGCTGACGTCA-3'), ABRE elements, G-box-like motif (5'-CCACGTGGCC-3'), DOF (5'-AAAG-3'), I-box (5'-GATAA-3'), BS1 (5'-AGCGGG-3'), MY3 (5'-CGACG-3'), 5'-CAGTGCGC-3' and 5'-ACTCAT-3' sequence in target gene promoters (PubMed:15047879, PubMed:16810321, PubMed:19531597, PubMed:21278122, PubMed:25108460). DNA-binding and subsequent transcription activation is triggered by heterodimerization with other bZIP proteins (e.g. BZIP1, BZIP10 and BZIP25) (PubMed:16810321, PubMed:19531597, PubMed:21278122). Promotes POX1/PRODH1 expression in response to hypoosmolarity stress (PubMed:15047879, PubMed:16810321). Transcriptional activator of seed maturation (MAT) genes (e.g. AT2S2), including seed storage protein (SSP) and late embryogenesis abundant (LEA) genes (PubMed:19531597). Activated by low energy stress both by transcriptional and post-transcriptional mechanisms. Promotes dark-induced senescence and participates in the transcriptional reprogramming of amino acid metabolism during the dark-induced starvation response, especially when heterodimerized with BZIP1, by triggering accumulation of sepcific proteins including ASN1 and POX1/PRODH1 (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:19531597, ECO:0000269|PubMed:21278122, ECO:0000269|PubMed:25108460}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By hypoosmolarity (PubMed:15047879, PubMed:16810321). Accumulates during dark-induced starvation (PubMed:21278122). {ECO:0000269|PubMed:15047879, ECO:0000269|PubMed:16810321, ECO:0000269|PubMed:21278122}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011079554.1 | 1e-73 | bZIP transcription factor 53 | ||||
Swissprot | Q9LZP8 | 6e-47 | BZP53_ARATH; bZIP transcription factor 53 | ||||
TrEMBL | A0A2G9G0L6 | 5e-72 | A0A2G9G0L6_9LAMI; Uncharacterized protein | ||||
STRING | Migut.D00084.1.p | 7e-71 | (Erythranthe guttata) |
Publications ? help Back to Top | |||
---|---|---|---|
|