PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_531_iso_11
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 310aa    MW: 35040.5 Da    PI: 9.6831
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                                         SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
                      Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                                         +WT+ E + + +a + + ++   +W ++a +++ g+t  +++  ++ 
  cra_locus_531_iso_11_len_1893_ver_3 24 KWTPAENKAFENALAVFDKDtpdRWQRVADMVP-GKTVLDVIRQYRE 69
                                         8********************************.*******999986 PP

                                          SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                      Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                          +WT+eE++l++ + k++G+g+W+ I+r +  +Rt+ q+ s+ qky
  cra_locus_531_iso_11_len_1893_ver_3 134 PWTEEEHKLFLMGLKKYGKGDWRNISRNFVITRTPTQVASHAQKY 178
                                          8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.782073IPR017884SANT domain
SMARTSM007172.8E-92173IPR001005SANT/Myb domain
CDDcd001671.10E-62470No hitNo description
PfamPF002493.1E-62469IPR001005SANT/Myb domain
PROSITE profilePS5129421.59127183IPR017930Myb domain
TIGRFAMsTIGR015572.0E-17130182IPR006447Myb domain, plants
SMARTSM007173.2E-13131181IPR001005SANT/Myb domain
PfamPF002495.6E-13134178IPR001005SANT/Myb domain
CDDcd001675.41E-11134179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027152581.11e-153transcription factor DIVARICATA
SwissprotQ8S9H71e-137DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A068UL311e-141A0A068UL31_COFCA; Uncharacterized protein
STRINGXP_009603384.11e-136(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Publications ? help Back to Top
  1. Galego L,Almeida J
    Role of DIVARICATA in the control of dorsoventral asymmetry in Antirrhinum flowers.
    Genes Dev., 2002. 16(7): p. 880-91
  2. Almeida J,Rocheta M,Galego L
    Genetic control of flower shape in Antirrhinum majus.
    Development, 1997. 124(7): p. 1387-92