PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_4695_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 279aa    MW: 30920 Da    PI: 4.6077
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_4695_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC621.2e-196861898
                                NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflv 93
                                         ++++P arikki++adedv +i+  +Pvl+ska elf+ +l  r++  +     +t++   ++++v++ +++dfl 
  cra_locus_4695_iso_2_len_2434_ver_3  6 DTRFPAARIKKIMQADEDVGKIAMAVPVLVSKALELFLQDLCDRTYDITLRRGAKTVNSLHLKQCVQSYNVYDFLR 81
                                         5789************************************************************************ PP

                                NF-YC 94 divpr 98
                                         div r
  cra_locus_4695_iso_2_len_2434_ver_3 82 DIVSR 86
                                         **987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-26372IPR009072Histone-fold
SuperFamilySSF471132.37E-20488IPR009072Histone-fold
PfamPF008088.2E-20871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MRKKLDTRFP AARIKKIMQA DEDVGKIAMA VPVLVSKALE LFLQDLCDRT YDITLRRGAK  60
TVNSLHLKQC VQSYNVYDFL RDIVSRVPDL GGSEGAGDGT AHRKRKVTME EDNDSDDEYK  120
KSHLLEAGHT SGRGRGRGRG RGRGRGSRAL QKESSSHHGR FEDDPDISEQ ANEEKDINSE  180
ILDNGASEKD SKETLVAKNP DVPAQNFDLN MDLNENTDTT AVTAGVTSST TPAKPSAETK  240
QEEYPGWSLA EMEQMAIDPV QLANMNQGDE EEEDYDEEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-23272575Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1134144RGRGRGRGRGR
2136145RGRGRGRGRG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027179024.11e-127dr1-associated corepressor-like isoform X1
RefseqXP_027179032.11e-127dr1-associated corepressor-like isoform X1
RefseqXP_027179037.11e-127dr1-associated corepressor-like isoform X1
TrEMBLA0A068UMH51e-124A0A068UMH5_COFCA; Uncharacterized protein
STRINGXP_009797323.17e-97(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA75552029