PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_46079_iso_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 92aa MW: 11354.9 Da PI: 10.0996 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.1 | 6.5e-11 | 31 | 70 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 +T++E++l+++ +k+ G + W++Ia +++ gRt++++ +w+ cra_locus_46079_iso_2_len_362_ver_3 31 MTEQEEDLIYRMHKLVGDR-WELIAGRIP-GRTPEEIERFWL 70 7****************99.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.5E-8 | 27 | 75 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 3.95E-7 | 30 | 71 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 8.2E-12 | 31 | 70 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 4.0E-10 | 31 | 71 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 7.41E-9 | 32 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.551 | 32 | 69 | IPR017877 | Myb-like domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 92 aa Download sequence Send to blast |
MDKRRTKQRK VVRSSAYEVE VSSIEWEFIN MTEQEEDLIY RMHKLVGDRW ELIAGRIPGR 60 TPEEIERFWL MRHNDGFASR RRSEYKRRCS KY |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 3 | 9 | RRTKQRK |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027109605.1 | 2e-42 | transcription factor TRY | ||||
Swissprot | Q8GV05 | 2e-34 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | B9I8W0 | 2e-38 | B9I8W0_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0014s09200.1 | 3e-39 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11707 | 18 | 24 |