PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_45277_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 151aa MW: 17724.8 Da PI: 10.2391 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 4e-17 | 43 | 88 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ed +l+++v+q G+ +W++Ia++++ gR++k+c++rw++ cra_locus_45277_iso_1_len_452_ver_3 43 RGHWRPNEDAKLKELVAQNGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 88 899*****************************.***********996 PP | |||||||
2 | Myb_DNA-binding | 55.9 | 1e-17 | 95 | 138 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 ++++T++E+e+l+ a+k++G++ W++Ia+ ++ gRt++++k+ w+ cra_locus_45277_iso_1_len_452_ver_3 95 KKAFTEDEEERLLAAHKMYGTK-WALIAKLFP-GRTDNSVKNQWHV 138 679*******************.*********.***********86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 17.999 | 38 | 89 | IPR017930 | Myb domain |
SMART | SM00717 | 9.4E-13 | 42 | 91 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.8E-16 | 43 | 88 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.01E-27 | 43 | 136 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.4E-26 | 44 | 96 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.59E-10 | 46 | 87 | No hit | No description |
PROSITE profile | PS51294 | 24.86 | 90 | 144 | IPR017930 | Myb domain |
SMART | SM00717 | 2.9E-15 | 94 | 142 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-15 | 95 | 137 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.68E-10 | 97 | 137 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 4.3E-21 | 97 | 143 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0051782 | Biological Process | negative regulation of cell division | ||||
GO:0071367 | Biological Process | cellular response to brassinosteroid stimulus | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0001046 | Molecular Function | core promoter sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
VMNNNCWAFC SNGTETKWRE TDGKMNDIEV KKRSHGHTKI CGRGHWRPNE DAKLKELVAQ 60 NGPQNWNLIA EKLQGRSGKS CRLRWFNQLD PRINKKAFTE DEEERLLAAH KMYGTKWALI 120 AKLFPGRTDN SVKNQWHVIM SRKQREEENN X |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 1e-30 | 43 | 143 | 7 | 107 | B-MYB |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 30 | 34 | KKRSH |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269|PubMed:20305120}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00516 | DAP | Transfer from AT5G17800 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by wounding. {ECO:0000269|PubMed:20305120}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020701779.1 | 4e-68 | transcription factor MYB54-like | ||||
Swissprot | Q5NBM8 | 1e-64 | CSA_ORYSJ; Transcription factor CSA | ||||
TrEMBL | A0A2I0X6L1 | 1e-66 | A0A2I0X6L1_9ASPA; Transcription factor MYB44 | ||||
STRING | evm.model.supercontig_73.4 | 3e-66 | (Carica papaya) | ||||
STRING | cassava4.1_009525m | 1e-65 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1684 | 24 | 70 |