PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_3902_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 72aa MW: 8204.35 Da PI: 4.1598 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 49.1 | 1.3e-15 | 11 | 68 | 3 | 60 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrk 60 ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c+re+ + cra_locus_3902_iso_1_len_687_ver_3 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCNREEER 68 6899**************************************************9876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.0E-20 | 9 | 67 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.95E-17 | 12 | 66 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.7E-16 | 14 | 67 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 72 aa Download sequence Send to blast |
MEPMDIVGRT KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE 60 VCNREEERDY SS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1jfi_B | 1e-16 | 12 | 71 | 12 | 70 | Transcription Regulator NC2 beta chain |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011096999.1 | 3e-42 | protein Dr1 homolog | ||||
Refseq | XP_011097000.1 | 3e-42 | protein Dr1 homolog | ||||
Swissprot | P49592 | 1e-39 | NC2B_ARATH; Protein Dr1 homolog | ||||
TrEMBL | A0A2G9G6G6 | 6e-41 | A0A2G9G6G6_9LAMI; Class 2 transcription repressor NC2, beta subunit (Dr1) | ||||
STRING | XP_007155169.1 | 1e-40 | (Phaseolus vulgaris) |
Publications ? help Back to Top | |||
---|---|---|---|
|