PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

cra_locus_31747_iso_3

Organism

Catharanthus roseus

Taxonomic ID

4058

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus

Family

NAC

Protein Properties

Length: 127aa MW: 14950.7 Da PI: 9.0331

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
cra_locus_31747_iso_3	genome	MPGR	-

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	139.7	1.8e-43	2	110	22	129
NAM 22 kvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 k+++k+++l +vik+vd+yk+ePwdL++ k+++ e++ewyfFs++dkky+tg+r+nrat +g+Wkatg+dk+v cra_locus_31747_iso_3_len_378_ver_3 2 KIASKRIDL-DVIKDVDLYKIEPWDLQElcKISNdEQNEWYFFSHKDKKYPTGTRTNRATIAGFWKATGRDKAV 74 788999999.99************954555542556******************************** PP NAM 93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129 ++ k++l+g++ktLvfykgrap+g+ktdW+mheyrle cra_locus_31747_iso_3_len_378_ver_3 75 YD-KSKLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 110 .999*****************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	45.649	1	127	IPR003441	NAC domain
SuperFamily	SSF101941	1.31E-45	2	126	IPR003441	NAC domain
Pfam	PF02365	6.0E-17	31	109	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 127 aa Download sequence Send to blast
XKIASKRIDL DVIKDVDLYK IEPWDLQELC KISNDEQNEW YFFSHKDKKY PTGTRTNRAT 60 IAGFWKATGR DKAVYDKSKL IGMRKTLVFY KGRAPNGQKT DWIMHEYRLE SEENGPPQEE 120 GWVVCRA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-37	2	126	36	164	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250\|UniProtKB:Q9LVA1, ECO:0000269\|PubMed:25148240}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028090380.1	5e-83	NAC domain-containing protein 37-like
Refseq	XP_028090381.1	5e-83	NAC domain-containing protein 37-like
Refseq	XP_028090382.1	5e-83	NAC domain-containing protein 37-like
Refseq	XP_028090383.1	5e-83	NAC domain-containing protein 37-like
Swissprot	O65508	5e-82	NAC76_ARATH; NAC domain-containing protein 76
TrEMBL	A0A067G6T6	1e-81	A0A067G6T6_CITSI; Uncharacterized protein
TrEMBL	A0A2R6RIT8	2e-81	A0A2R6RIT8_ACTCH; NAC domain-containing protein
TrEMBL	V4SNX0	1e-81	V4SNX0_9ROSI; Uncharacterized protein
STRING	XP_006425526.1	3e-82	(Citrus clementina)

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Tan TT, et al. Transcription Factors VND1-VND3 Contribute to Cotyledon Xylem Vessel Formation. Plant Physiol., 2018. 176(1): p. 773-789 [PMID:29133368]