PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_2625_iso_9 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 171aa MW: 18384.3 Da PI: 5.7398 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.2 | 1e-57 | 35 | 131 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatl 74 vreqdrflPian+srimkk+lPan+ki+kd+ketvqecvsefisf+tseasdkcq+ekrktingddllwa+atl cra_locus_2625_iso_9_len_1104_ver_3 35 VREQDRFLPIANISRIMKKALPANGKIAKDSKETVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATL 108 69************************************************************************ PP NF-YB 75 Gfedyveplkvylkkyrelegek 97 Gfe+yv+plk+yl++yreleg++ cra_locus_2625_iso_9_len_1104_ver_3 109 GFEEYVDPLKAYLARYRELEGDT 131 ********************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.2E-54 | 32 | 148 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.16E-40 | 38 | 155 | IPR009072 | Histone-fold |
Pfam | PF00808 | 6.6E-28 | 41 | 105 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 9.9E-21 | 69 | 87 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 72 | 88 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 9.9E-21 | 88 | 106 | No hit | No description |
PRINTS | PR00615 | 9.9E-21 | 107 | 125 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 171 aa Download sequence Send to blast |
MADATQSSSQ GAAAPASSGG GSHESGDQSP RSGGVREQDR FLPIANISRI MKKALPANGK 60 IAKDSKETVQ ECVSEFISFI TSEASDKCQK EKRKTINGDD LLWAMATLGF EEYVDPLKAY 120 LARYRELEGD TRVNSRGGEG SANTIEAHLG PNAEFVRQGS FTHNLSTNSQ I |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 5e-47 | 36 | 126 | 3 | 93 | NF-YB |
4awl_B | 5e-47 | 36 | 126 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 5e-47 | 36 | 126 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027065742.1 | 4e-87 | nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Refseq | XP_027065743.1 | 4e-87 | nuclear transcription factor Y subunit B-10-like isoform X1 | ||||
Refseq | XP_027065745.1 | 2e-87 | nuclear transcription factor Y subunit B-10-like isoform X3 | ||||
Swissprot | Q67XJ2 | 1e-71 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | B9IIZ5 | 8e-84 | B9IIZ5_POPTR; Uncharacterized protein | ||||
STRING | XP_010667231.1 | 5e-83 | (Beta vulgaris) |
Publications ? help Back to Top | |||
---|---|---|---|
|