PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_2625_iso_11 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 162aa MW: 17615.7 Da PI: 5.0515 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 183.3 | 2e-57 | 26 | 122 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalat 73 vreqdrflPian++rimkk+lPan+ki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+at cra_locus_2625_iso_11_len_1136_ver_3 26 VREQDRFLPIANIGRIMKKALPANGKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMAT 98 69*********************************************************************** PP NF-YB 74 lGfedyveplkvylkkyrelegek 97 lGfe+yv+plk+yl++yreleg++ cra_locus_2625_iso_11_len_1136_ver_3 99 LGFEEYVDPLKAYLARYRELEGDT 122 *********************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.2E-54 | 21 | 139 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.42E-40 | 29 | 146 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-28 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.8E-21 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.8E-21 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 8.8E-21 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 162 aa Download sequence Send to blast |
MAEAPPVSPV GGGIESGGDQ SPQSNVREQD RFLPIANIGR IMKKALPANG KIAKEAKDTV 60 QECVSEFISF ITSEASDKCQ KEKRKTINGD DLLWAMATLG FEEYVDPLKA YLARYRELEG 120 DTRVNSRGGE GSANTIEAHL GPNAEFVRQG SFTHNLSTNS QI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-46 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-46 | 26 | 117 | 1 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028103481.1 | 1e-88 | nuclear transcription factor Y subunit B-1-like | ||||
Refseq | XP_028122302.1 | 2e-88 | nuclear transcription factor Y subunit B-1-like | ||||
Swissprot | Q8VYK4 | 3e-69 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A1B0T703 | 2e-82 | A0A1B0T703_CHRMO; NF-Y protein (Fragment) | ||||
TrEMBL | A0A2U1QNJ1 | 2e-82 | A0A2U1QNJ1_ARTAN; NF-Y protein | ||||
STRING | VIT_13s0019g03600.t01 | 1e-81 | (Vitis vinifera) |
Publications ? help Back to Top | |||
---|---|---|---|
|