PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_2554_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 215aa    MW: 23895.8 Da    PI: 6.296
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_2554_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC79.54.3e-259114052101
                                NF-YC  52 elfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprdel 101
                                          e+fileltlr+w+h+eenkrrtl+k+diaaa+trtdifdflvdivpr+el
  cra_locus_2554_iso_1_len_1239_ver_3  91 EMFILELTLRAWNHTEENKRRTLQKNDIAAAITRTDIFDFLVDIVPREEL 140
                                          9**********************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471136.74E-1487137IPR009072Histone-fold
Gene3DG3DSA:1.10.20.101.5E-1889137IPR009072Histone-fold
PfamPF008083.6E-690122IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MDQQGNGQPP GMGVVGSSAH VPYTIAPYQT NQMTSHSPPA SAGAVQTPQT AGLPSSAQMA  60
QHQLAYQHIH HQQQQQLQQQ LQNFWSNQYQ EMFILELTLR AWNHTEENKR RTLQKNDIAA  120
AITRTDIFDF LVDIVPREEL KDEMLASIPR GSLPVGAPAE GVPYYYMPTQ SAPQVGASGM  180
YVGKPVDQAL YGQQPRPPYM PPQMWPHQQP PPADS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B8e-28911374995NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109115RRTLQKN
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters (By similarity). Interacts with REF6 to directly regulate SOC1 transcription in response to flowering signals from photoperiod and gibberellic acid pathways (PubMed:25105952). {ECO:0000250, ECO:0000269|PubMed:25105952}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027121247.11e-114nuclear transcription factor Y subunit C-9-like isoform X1
RefseqXP_027121248.11e-114nuclear transcription factor Y subunit C-9-like isoform X1
SwissprotQ8L4B25e-44NFYC9_ARATH; Nuclear transcription factor Y subunit C-9
TrEMBLA0A076FU264e-93A0A076FU26_TOBAC; CONSTANS interacting protein 2b
TrEMBLA0A314L5H73e-93A0A314L5H7_NICAT; Nuclear transcription factor y subunit c-9
STRINGXP_009590081.16e-94(Nicotiana tomentosiformis)
Publications ? help Back to Top
  1. Hwang YH, et al.
    Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time.
    Plant Cell Rep., 2016. 35(4): p. 857-65
    [PMID:26754793]
  2. Liu X, et al.
    The NF-YC-RGL2 module integrates GA and ABA signalling to regulate seed germination in Arabidopsis.
    Nat Commun, 2016. 7: p. 12768
    [PMID:27624486]
  3. Myers ZA, et al.
    NUCLEAR FACTOR Y, Subunit C (NF-YC) Transcription Factors Are Positive Regulators of Photomorphogenesis in Arabidopsis thaliana.
    PLoS Genet., 2016. 12(9): p. e1006333
    [PMID:27685091]
  4. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  5. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]
  6. Gnesutta N, et al.
    CONSTANS Imparts DNA Sequence Specificity to the Histone Fold NF-YB/NF-YC Dimer.
    Plant Cell, 2017. 29(6): p. 1516-1532
    [PMID:28526714]
  7. Bi C,Ma Y,Wang XF,Zhang DP
    Overexpression of the transcription factor NF-YC9 confers abscisic acid hypersensitivity in Arabidopsis.
    Plant Mol. Biol., 2017. 95(4-5): p. 425-439
    [PMID:28924726]
  8. Liu X, et al.
    Temporal-Specific Interaction of NF-YC and CURLY LEAF during the Floral Transition Regulates Flowering.
    Plant Physiol., 2018. 177(1): p. 105-114
    [PMID:29599268]