PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_2272_iso_9 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 227aa MW: 26601.7 Da PI: 7.2716 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 99.5 | 1.3e-31 | 26 | 75 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+ cra_locus_2272_iso_9_len_1129_ver_3 26 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 75 79***********************************************8 PP | |||||||
2 | K-box | 24.4 | 1.2e-09 | 126 | 158 | 68 | 100 |
K-box 68 kKnellleqieelqkkekelqeenkaLrkklee 100 k +ell+++ie++qk+e +l+++n++Lr+k++e cra_locus_2272_iso_9_len_1129_ver_3 126 KEEELLFAEIEYMQKREIDLHNNNQYLRAKIAE 158 5689**************************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.4E-41 | 18 | 77 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 33.669 | 18 | 78 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.89E-41 | 19 | 78 | No hit | No description |
SuperFamily | SSF55455 | 6.28E-30 | 19 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 20 | 40 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 20 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 8.0E-27 | 27 | 74 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 40 | 55 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.7E-33 | 55 | 76 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0006563 | Biological Process | L-serine metabolic process | ||||
GO:0007623 | Biological Process | circadian rhythm | ||||
GO:0009409 | Biological Process | response to cold | ||||
GO:0009416 | Biological Process | response to light stimulus | ||||
GO:0009853 | Biological Process | photorespiration | ||||
GO:0019464 | Biological Process | glycine decarboxylation via glycine cleavage system | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0005739 | Cellular Component | mitochondrion | ||||
GO:0005886 | Cellular Component | plasma membrane | ||||
GO:0009534 | Cellular Component | chloroplast thylakoid | ||||
GO:0009570 | Cellular Component | chloroplast stroma | ||||
GO:0010319 | Cellular Component | stromule | ||||
GO:0022626 | Cellular Component | cytosolic ribosome | ||||
GO:0048046 | Cellular Component | apoplast | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0004372 | Molecular Function | glycine hydroxymethyltransferase activity | ||||
GO:0008266 | Molecular Function | poly(U) RNA binding | ||||
GO:0030170 | Molecular Function | pyridoxal phosphate binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 227 aa Download sequence Send to blast |
MANYQSDQSR EMSPLRRLGR GKIEIKRIEN TTNRQVTFCK RRNGLLKKAY ELSVLCDAEV 60 ALIVFSSRGR LYEYANNSXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXN 120 QQDPIKEEEL LFAEIEYMQK REIDLHNNNQ YLRAKIAETE RAHEQPAVNL MPAGSSEYEM 180 VQTHHHQQQQ QYDAARNFLQ VNGLQSNDHY SRHHDQPPPP PPPLQLV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1tqe_P | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_R | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
1tqe_S | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_A | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_B | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_C | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_D | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_E | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
6c9l_F | 3e-20 | 18 | 77 | 1 | 60 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008371525.2 | 4e-62 | floral homeotic protein AGAMOUS-like isoform X1 | ||||
Refseq | XP_008371527.2 | 4e-62 | floral homeotic protein AGAMOUS-like isoform X2 | ||||
Refseq | XP_008371528.2 | 4e-62 | floral homeotic protein AGAMOUS-like isoform X3 | ||||
Swissprot | Q43585 | 5e-43 | AG_TOBAC; Floral homeotic protein AGAMOUS | ||||
TrEMBL | A0A1P8D410 | 4e-63 | A0A1P8D410_9LAMI; AGAMOUS-like protein | ||||
STRING | XP_008371525.1 | 2e-61 | (Malus domestica) |
Publications ? help Back to Top | |||
---|---|---|---|
|