PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_22298_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 89aa MW: 9880.69 Da PI: 10.0784 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 135.4 | 1.3e-42 | 24 | 89 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 +eakG+nPGlivll+vgglll+fl+gny+ly+yaqk+lPP+kkkPvskkk+k+e+lkqGv++PGe cra_locus_22298_iso_1_len_755_ver_3 24 DAEAKGFNPGLIVLLLVGGLLLTFLIGNYVLYIYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE 89 68***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD019013 | 0.008 | 24 | 89 | No hit | No description |
Pfam | PF04689 | 1.4E-40 | 25 | 89 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 89 aa Download sequence Send to blast |
MDYEGDFDDH APPAFDRMKN VGMDAEAKGF NPGLIVLLLV GGLLLTFLIG NYVLYIYAQK 60 TLPPKKKKPV SKKKMKKERL KQGVSAPGE |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024983185.1 | 8e-34 | DNA-binding protein S1FA-like | ||||
Swissprot | Q42337 | 6e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | B9SGP8 | 7e-29 | B9SGP8_RICCO; DNA-binding protein S1FA, putative | ||||
STRING | Lus10023177 | 3e-31 | (Linum usitatissimum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |