PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_20943_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 206aa MW: 23667.7 Da PI: 8.9761 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.4 | 1.2e-25 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 k+ien rqvtf+kRr+g+lKKA+ELSvLCdae+ ++ifs +gklye + cra_locus_20943_iso_1_len_929_ver_3 9 KKIENPVHRQVTFCKRRAGLLKKAKELSVLCDAEIGLVIFSAHGKLYELA 58 68*********************************************965 PP | |||||||
2 | K-box | 58.3 | 3.3e-20 | 86 | 176 | 12 | 100 |
K-box 12 akaeslqqelakLkkeienLqreqRhllGe..dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83 + ++ ++e++kLk+eie Lq+ ++ + G + +++sl eL Le++Le + +iRs K+++++++i+ l++k cra_locus_20943_iso_1_len_929_ver_3 86 QLQQDPREEISKLKQEIEVLQKGLKYMSGGvaGHGTMSLDELDMLEKHLEIWIYHIRSAKMDIMFQEIQLLKNK 159 55677899***************9999996226689************************************** PP K-box 84 ekelqeenkaLrkklee 100 e l+ +nk+L++k++e cra_locus_20943_iso_1_len_929_ver_3 160 EGILKAANKYLQEKIDE 176 **************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 8.5E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 29.997 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 6.15E-28 | 1 | 74 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.75E-40 | 2 | 78 | No hit | No description |
PRINTS | PR00404 | 3.3E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.8E-23 | 10 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 3.3E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 12.656 | 88 | 180 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 4.4E-21 | 88 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0048364 | Biological Process | root development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 206 aa Download sequence Send to blast |
MARGKIQMKK IENPVHRQVT FCKRRAGLLK KAKELSVLCD AEIGLVIFSA HGKLYELATK 60 GTMQGLMEKY MKTTRGAAPD EQPPDQLQQD PREEISKLKQ EIEVLQKGLK YMSGGVAGHG 120 TMSLDELDML EKHLEIWIYH IRSAKMDIMF QEIQLLKNKE GILKAANKYL QEKIDEQYRI 180 TDMVPMMTTT NIPYGPLTIH NEIFQF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 6e-16 | 1 | 85 | 1 | 81 | MEF2 CHIMERA |
6byy_B | 6e-16 | 1 | 85 | 1 | 81 | MEF2 CHIMERA |
6byy_C | 6e-16 | 1 | 85 | 1 | 81 | MEF2 CHIMERA |
6byy_D | 6e-16 | 1 | 85 | 1 | 81 | MEF2 CHIMERA |
6bz1_A | 6e-16 | 1 | 87 | 1 | 83 | MEF2 CHIMERA |
6bz1_B | 6e-16 | 1 | 87 | 1 | 83 | MEF2 CHIMERA |
6bz1_C | 6e-16 | 1 | 87 | 1 | 83 | MEF2 CHIMERA |
6bz1_D | 6e-16 | 1 | 87 | 1 | 83 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269|PubMed:18203871}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By auxin in root phloem. {ECO:0000269|PubMed:18203871}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027091062.1 | 1e-119 | agamous-like MADS-box protein AGL12 | ||||
Refseq | XP_027148112.1 | 1e-119 | agamous-like MADS-box protein AGL12 | ||||
Swissprot | Q38841 | 6e-79 | AGL12_ARATH; Agamous-like MADS-box protein AGL12 | ||||
TrEMBL | A0A3Q7IV00 | 1e-105 | A0A3Q7IV00_SOLLC; Uncharacterized protein | ||||
STRING | Solyc11g032100.1.1 | 1e-105 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA9810 | 20 | 24 |
Publications ? help Back to Top | |||
---|---|---|---|
|