PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_19246_iso_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 153aa MW: 17795.8 Da PI: 7.0747 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.3 | 3.4e-10 | 79 | 114 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+ +gL+++q+ +WF N+R ++ cra_locus_19246_iso_2_len_529_ver_3 79 YKWPYPSETEKVALAEATGLDQKQINNWFINQRKRH 114 5679*****************************985 PP | |||||||
2 | ELK | 39.5 | 1.2e-13 | 34 | 55 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++LlrKYsgyL+sLkqE+s cra_locus_19246_iso_2_len_529_ver_3 34 ELKNHLLRKYSGYLSSLKQELS 55 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01188 | 3.5E-7 | 34 | 55 | IPR005539 | ELK domain |
PROSITE profile | PS51213 | 11.296 | 34 | 54 | IPR005539 | ELK domain |
Pfam | PF03789 | 7.9E-11 | 34 | 55 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.811 | 54 | 117 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.97E-20 | 55 | 129 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 1.5E-12 | 56 | 121 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 6.9E-28 | 59 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 5.83E-12 | 66 | 118 | No hit | No description |
Pfam | PF05920 | 3.8E-17 | 74 | 113 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 92 | 115 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
XEKCEGVGSS EEDQDNSGGE TELPEIDPRA EDRELKNHLL RKYSGYLSSL KQELSKKKKK 60 GKLPKDARQK LLSWWELHYK WPYPSETEKV ALAEATGLDQ KQINNWFINQ RKRHWKPSED 120 MQFMVMDGLH PQNAAALYME GHYMGEGPYR LGP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Appears to be involved in meristem formation and in the regulation of leaf morphology. Misexpression makes the leaf more compound which is always associated with growth retardation and loss of apical dominance, resulting in dwarfed, bushy plants. Probably binds to the DNA sequence 5'-TGAC-3'. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016441623.1 | 9e-97 | PREDICTED: homeotic protein knotted-1-like isoform X2 | ||||
Refseq | XP_022870905.1 | 1e-96 | homeotic protein knotted-1 isoform X1 | ||||
Swissprot | Q41330 | 5e-97 | KN1_SOLLC; Homeotic protein knotted-1 | ||||
TrEMBL | A0A2R6Q0L0 | 6e-96 | A0A2R6Q0L0_ACTCH; Homeotic protein like | ||||
STRING | XP_009598343.1 | 4e-96 | (Nicotiana tomentosiformis) |