PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_17679_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 197aa MW: 21492.9 Da PI: 5.1446 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 38.4 | 3e-12 | 83 | 120 | 16 | 55 |
AP2 16 vAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +AeIrdp +ng +r++lg+f tae+Aa a+++a+ +++g cra_locus_17679_iso_1_len_1021_ver_3 83 AAEIRDPAKNG--ARVWLGTFETAEDAALAYDRAAYRMRG 120 69*****9987..*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51032 | 18.558 | 64 | 128 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 7.19E-17 | 78 | 130 | IPR016177 | DNA-binding domain |
Gene3D | G3DSA:3.30.730.10 | 5.3E-23 | 79 | 128 | IPR001471 | AP2/ERF domain |
CDD | cd00018 | 1.52E-21 | 80 | 128 | No hit | No description |
SMART | SM00380 | 2.2E-22 | 80 | 134 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 1.6E-6 | 84 | 120 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0001944 | Biological Process | vasculature development | ||||
GO:0009864 | Biological Process | induced systemic resistance, jasmonic acid mediated signaling pathway | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0051301 | Biological Process | cell division | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 197 aa Download sequence Send to blast |
MYENGDFDAD LALLDSIRRH LLGESLSESP GTFSGESPTG MYGGSGKDSE EQMLIYSFLN 60 EATTITAVKM EPGSEKAAVG KIAAEIRDPA KNGARVWLGT FETAEDAALA YDRAAYRMRG 120 SRALLNFPLR INSGEPEPVR ITSKRSNSNS NSSTSSPSNS PSLKRKKAIK VAEPPVLVVE 180 QDTEHRGYGE QRLFSEW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2gcc_A | 8e-32 | 80 | 135 | 15 | 70 | ATERF1 |
3gcc_A | 8e-32 | 80 | 135 | 15 | 70 | ATERF1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. Involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways. Involved in disease resistance pathways. {ECO:0000269|PubMed:10715325, ECO:0000269|PubMed:12805630, ECO:0000269|PubMed:9756931}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00548 | DAP | Transfer from AT5G47220 | Download |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by jasmonate (JA) and Alternaria brassicicola (locally and systemically). Ethylene induction is completely dependent on a functional ETHYLENE-INSENSITIVE2 (EIN2) while wounding induction does not require EIN2. Transcripts accumulate strongly in cycloheximide-treated plants, a protein synthesis inhibitor. Seems to not be influenced by exogenous abscisic acid (ABA), cold, heat, NaCl or drought stress. {ECO:0000269|PubMed:10715325, ECO:0000269|PubMed:12805630}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_028112381.1 | 2e-49 | ethylene-responsive transcription factor 1A-like | ||||
Swissprot | O80338 | 1e-42 | EF101_ARATH; Ethylene-responsive transcription factor 2 | ||||
TrEMBL | A0A068UQX4 | 1e-53 | A0A068UQX4_COFCA; Uncharacterized protein | ||||
STRING | EOY24233 | 1e-45 | (Theobroma cacao) | ||||
STRING | GLYMA17G15480.1 | 9e-46 | (Glycine max) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA21 | 24 | 1165 |
Publications ? help Back to Top | |||
---|---|---|---|
|