PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_15848_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 242aa    MW: 26131.3 Da    PI: 4.8601
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_15848_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC178.46.6e-56331371102
                                 NF-YC   1 qlksfwekq...iekatdfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenk 70 
                                           ql+ fw++q   ie+++dfknh+lPlarikki+kadedv+misaeaP+l++kacelfilelt+rswlhaeenk
  cra_locus_15848_iso_2_len_1592_ver_3  33 QLQLFWNYQrqeIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENK 105
                                           79*****998899************************************************************ PP

                                 NF-YC  71 rrtlkksdiaaavtrtdifdflvdivprdelk 102
                                           rrtl+k+diaaa+trtdifdflvdivprde+k
  cra_locus_15848_iso_2_len_1592_ver_3 106 RRTLQKNDIAAAITRTDIFDFLVDIVPRDEIK 137
                                           *****************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471134.69E-3414127IPR009072Histone-fold
PfamPF008081.7E-2055118IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.107.4E-3756133IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MENNSQQATA PTQSSVYPAQ PPYHHLLQQQ QQQLQLFWNY QRQEIEQVND FKNHQLPLAR  60
IKKIMKADED VRMISAEAPI LFAKACELFI LELTIRSWLH AEENKRRTLQ KNDIAAAITR  120
TDIFDFLVDI VPRDEIKDEA ASLGVGVGVG VGPGGMAVGS AASGVPYYYP PMGQPAPPGV  180
MIGRPAVDPA VYVQPPPPPS QAWQSVWQTA AATTEDGSYV SGGAAGASSG GQGNLDGHDG  240
QG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_B4e-5541133395NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105111RRTLQKN
Functional Description ? help Back to Top
Source Description
UniProtStimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009619035.11e-123PREDICTED: nuclear transcription factor Y subunit C-1-like
RefseqXP_016439532.11e-123PREDICTED: nuclear transcription factor Y subunit C-1-like
SwissprotQ9SMP01e-104NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
TrEMBLA0A1S3XIN11e-121A0A1S3XIN1_TOBAC; nuclear transcription factor Y subunit C-1-like
STRINGXP_009619035.11e-122(Nicotiana tomentosiformis)
Publications ? help Back to Top
  1. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2015.
    [PMID:24831307]
  2. Shi H,Chan ZL
    AtHAP5A modulates freezing stress resistance in Arabidopsis independent of the CBF pathway.
    Plant Signal Behav, 2014. 9(7): p. e29109
    [PMID:25763489]
  3. Tang Y, et al.
    Arabidopsis NF-YCs Mediate the Light-Controlled Hypocotyl Elongation via Modulating Histone Acetylation.
    Mol Plant, 2017. 10(2): p. 260-273
    [PMID:27876642]
  4. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]