PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_15191_iso_3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 183aa MW: 21412.6 Da PI: 9.4863 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.5 | 1.8e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+n + rqvtfskRr g++KKAeELSvLCda+v +iifsstgkl+eyss cra_locus_15191_iso_3_len_1458_ver_3 9 KKIDNATARQVTFSKRRRGLFKKAEELSVLCDADVGLIIFSSTGKLFEYSS 59 68***********************************************96 PP | |||||||
2 | K-box | 53.9 | 7.8e-19 | 93 | 171 | 20 | 98 |
K-box 20 elakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 +++ L ke+ +++R++ GedL+ L++++LqqLe+ Le++l+++ +kK e ++++i++lq+k +l een+ cra_locus_15191_iso_3_len_1458_ver_3 93 NYTILSKEVADKSHQLRQMRGEDLQGLTIEDLQQLERSLETGLSRVIEKKGEKIMKEINHLQQKGMQLMEENE 165 5666777777778999********************************************************* PP K-box 93 aLrkkl 98 +Lr+++ cra_locus_15191_iso_3_len_1458_ver_3 166 KLRQQV 171 ****97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 6.2E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 30.291 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.36E-40 | 2 | 77 | No hit | No description |
PRINTS | PR00404 | 1.6E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 1.02E-31 | 3 | 80 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.0E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.6E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.469 | 87 | 177 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 5.7E-17 | 92 | 171 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 183 aa Download sequence Send to blast |
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAEELSVLCD ADVGLIIFSS TGKLFEYSSS 60 SMKEILERHN LHSKNLAKME QPSLELQLVE NSNYTILSKE VADKSHQLRQ MRGEDLQGLT 120 IEDLQQLERS LETGLSRVIE KKGEKIMKEI NHLQQKGMQL MEENEKLRQQ VVTKKNCYYH 180 YYY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_B | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_C | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
5f28_D | 1e-20 | 1 | 69 | 1 | 69 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027075278.1 | 1e-108 | MADS-box protein SVP-like | ||||
Refseq | XP_027078661.1 | 1e-108 | MADS-box protein SVP-like isoform X1 | ||||
Refseq | XP_027180140.1 | 1e-108 | MADS-box protein SVP | ||||
Swissprot | Q9FUY6 | 1e-103 | JOIN_SOLLC; MADS-box protein JOINTLESS | ||||
TrEMBL | A0A068U051 | 1e-107 | A0A068U051_COFCA; Uncharacterized protein | ||||
STRING | XP_009364259.1 | 1e-103 | (Pyrus x bretschneideri) |
Publications ? help Back to Top | |||
---|---|---|---|
|