PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_13761_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GRAS
Protein Properties Length: 471aa    MW: 52794.5 Da    PI: 6.3502
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_13761_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS479.31.9e-146464681374
                                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                                           l++lLl+cA++v++g+le+a+ +L ++s+laspdgd+mqR+a+yfteALa r+++++++lykal++++ s  +
  cra_locus_13761_iso_1_len_2494_ver_3  46 LIHLLLSCANHVATGSLENANMALDQISHLASPDGDTMQRIASYFTEALADRILKTWPGLYKALHSTKIS--T 116
                                           689*************************************************************999987..6 PP

                                  GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTg 146
                                            see+ ++k+f+e +P+lk++++++NqaI ea+ege+ vH+iD+++s+++QW aLlq L++Rpegpp+lRiTg
  cra_locus_13761_iso_1_len_2494_ver_3 117 ASEEILVRKMFFEFFPFLKVAFVITNQAIIEAMEGEKVVHVIDLNASEPAQWRALLQDLSARPEGPPHLRITG 189
                                           99*********************************************************************** PP

                                  GRAS 147 vgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll..... 214
                                           +++    +k+ l ++++ L++ Ae+l++pf+fn+ ++++le+l++e+Lrvk+gEala+++vlqlh+ll     
  cra_locus_13761_iso_1_len_2494_ver_3 190 IHQ----QKQVLDQMAHILTEDAEKLDIPFQFNP-IVSKLENLDVEKLRVKTGEALAISSVLQLHTLLasade 257
                                           ***....9**************************.7999********************************** PP

                                  GRAS 215 .....................................................desvsleserdevLklvksl 234
                                                                                                ++s+sl  + d++L+++++l
  cra_locus_13761_iso_1_len_2494_ver_3 258 iqqrrspivaknsnsqhlhrvlqmnqgtlgellekdlvngyspssdsasssplSSSASL--KLDSFLNALWGL 328
                                           ***********************************************886554444444..5699******** PP

                                  GRAS 235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerre 307
                                           sPk++vv+eq+++hn+++++er++e+l+yy+alfd+le++lpr+s er kvE++l+g ei+n++acegaer+e
  cra_locus_13761_iso_1_len_2494_ver_3 329 SPKIMVVAEQDSNHNGTTLMERLSESLHYYAALFDCLESTLPRTSLERLKVEKMLFGDEIKNIIACEGAERKE 401
                                           ************************************************************************* PP

                                  GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                                           rhe+lekW +rl+  GF++v ls++a+ qak+ll++++ +gy+++ee+g++v++W+drpL+svSaWr
  cra_locus_13761_iso_1_len_2494_ver_3 402 RHEKLEKWIQRLDLGGFGNVGLSYYAMLQAKRLLQTHSCEGYKIKEENGCVVICWQDRPLFSVSAWR 468
                                           ******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.98320448IPR005202Transcription factor GRAS
PfamPF035146.5E-14446468IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009739Biological Processresponse to gibberellin
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 471 aa     Download sequence    Send to blast
MFQDDGSSSV TSSPLQMFPM MSLSPGLGSP YPWLKELKSE ERGLYLIHLL LSCANHVATG  60
SLENANMALD QISHLASPDG DTMQRIASYF TEALADRILK TWPGLYKALH STKISTASEE  120
ILVRKMFFEF FPFLKVAFVI TNQAIIEAME GEKVVHVIDL NASEPAQWRA LLQDLSARPE  180
GPPHLRITGI HQQKQVLDQM AHILTEDAEK LDIPFQFNPI VSKLENLDVE KLRVKTGEAL  240
AISSVLQLHT LLASADEIQQ RRSPIVAKNS NSQHLHRVLQ MNQGTLGELL EKDLVNGYSP  300
SSDSASSSPL SSSASLKLDS FLNALWGLSP KIMVVAEQDS NHNGTTLMER LSESLHYYAA  360
LFDCLESTLP RTSLERLKVE KMLFGDEIKN IIACEGAERK ERHEKLEKWI QRLDLGGFGN  420
VGLSYYAMLQ AKRLLQTHSC EGYKIKEENG CVVICWQDRP LFSVSAWRCR R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A6e-40344707381Protein SCARECROW
5b3h_A5e-40294701380Protein SCARECROW
5b3h_D5e-40294701380Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027079709.10.0scarecrow-like protein 3
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLA0A068UJK60.0A0A068UJK6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000118390.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29142453
Publications ? help Back to Top
  1. Gong X, et al.
    SEUSS Integrates Gibberellin Signaling with Transcriptional Inputs from the SHR-SCR-SCL3 Module to Regulate Middle Cortex Formation in the Arabidopsis Root.
    Plant Physiol., 2016. 170(3): p. 1675-83
    [PMID:26818732]
  2. Lee SA, et al.
    Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue.
    Mol Plant, 2016. 9(6): p. 870-84
    [PMID:26970019]
  3. Choi JW,Lim J
    Control of Asymmetric Cell Divisions during Root Ground Tissue Maturation.
    Mol. Cells, 2016. 39(7): p. 524-9
    [PMID:27306644]