PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10464_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family GRAS
Protein Properties Length: 538aa    MW: 60435.5 Da    PI: 5.9036
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10464_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS448.35e-1371685381374
                                  GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn 73 
                                           l+++L++cA+a+s++d   aq l+++l++++s +g+p+qRl ay++e+L a+l+ s+s++yk+l+++e +   
  cra_locus_10464_iso_1_len_1949_ver_3 168 LKHVLVACAKAISENDYLTAQLLMTELRQMVSVSGEPIQRLGAYMLEGLVAKLTASGSSIYKSLRCKEPA--- 237
                                           689******************************************************************9... PP

                                  GRAS  74 sseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTg 146
                                           s e l+++++++ev+P++kf+++ aN aI ea++ e+rvHi+Df+i qG QW++L+qa+a+Rp+gpp++RiTg
  cra_locus_10464_iso_1_len_1949_ver_3 238 SFELLSYMHILYEVCPYFKFGYMSANGAIAEAMKDENRVHIVDFQIAQGSQWVTLIQAFAARPGGPPHIRITG 310
                                           9************************************************************************ PP

                                  GRAS 147 vgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldes 217
                                           +++++s   +   l+ +g+rL+++Ae+++vpfef++ ++ + +++++e+L ++pgEalaVn++++lh+++des
  cra_locus_10464_iso_1_len_1949_ver_3 311 IDDSTSAyaRGGGLNIVGQRLSRLAESFKVPFEFHA-ATISGSEIQPENLGIQPGEALAVNFAFMLHHMPDES 382
                                           ***998899999************************.7889******************************** PP

                                  GRAS 218 vsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                                           vs+e++rd++L++v++l+Pkvv++veqe+++n++sF+ rfle+++yy a+f+s++++lpre++eri+vE+++l
  cra_locus_10464_iso_1_len_1949_ver_3 383 VSTENHRDRILRMVRGLNPKVVTLVEQESNTNTSSFFPRFLETFDYYKAMFESIDVTLPREHKERINVEQHCL 455
                                           ************************************************************************* PP

                                  GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                                           ++++vn++acegaer+erhe l+kW+ r+++aGF+p+pls+ ++ ++k+ll+++ +  yr+ee++++l+lgW+
  cra_locus_10464_iso_1_len_1949_ver_3 456 AKDLVNIIACEGAERVERHELLGKWKLRFRMAGFSPYPLSSLVNGTIKTLLENYCD-KYRLEERDDALYLGWM 527
                                           ******************************************************95.5*************** PP

                                  GRAS 364 drpLvsvSaWr 374
                                           +r Lv+ +aW+
  cra_locus_10464_iso_1_len_1949_ver_3 528 NRDLVASCAWK 538
                                           **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098568.515142519IPR005202Transcription factor GRAS
PfamPF035141.7E-134168538IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0005737Cellular Componentcytoplasm
GO:0004871Molecular Functionsignal transducer activity
Sequence ? help Back to Top
Protein Sequence    Length: 538 aa     Download sequence    Send to blast
MSLSNALCLN LPVQKVEAYF LQQLPSLEPH LSYTHSNNNG NSYPIQISHD RYCTLESSSV  60
TANHNLYNSP STASFSPNGS PMSQQEYQSH ALDQVRSPDT NYGSPVSGSC VTEEVHDLRH  120
KLKELETAML GPDSDIFEVC EDTFSHGITS PEINIWRQMI EVIPRGDLKH VLVACAKAIS  180
ENDYLTAQLL MTELRQMVSV SGEPIQRLGA YMLEGLVAKL TASGSSIYKS LRCKEPASFE  240
LLSYMHILYE VCPYFKFGYM SANGAIAEAM KDENRVHIVD FQIAQGSQWV TLIQAFAARP  300
GGPPHIRITG IDDSTSAYAR GGGLNIVGQR LSRLAESFKV PFEFHAATIS GSEIQPENLG  360
IQPGEALAVN FAFMLHHMPD ESVSTENHRD RILRMVRGLN PKVVTLVEQE SNTNTSSFFP  420
RFLETFDYYK AMFESIDVTL PREHKERINV EQHCLAKDLV NIIACEGAER VERHELLGKW  480
KLRFRMAGFS PYPLSSLVNG TIKTLLENYC DKYRLEERDD ALYLGWMNRD LVASCAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-591725388375GRAS family transcription factor containing protein, expressed
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phytochrome A (phyA) signal transduction. {ECO:0000269|PubMed:10817761}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027061587.10.0scarecrow-like transcription factor PAT1
RefseqXP_027061588.10.0scarecrow-like transcription factor PAT1
RefseqXP_027061589.10.0scarecrow-like transcription factor PAT1
RefseqXP_027061590.10.0scarecrow-like transcription factor PAT1
RefseqXP_027064389.10.0scarecrow-like transcription factor PAT1
RefseqXP_027064390.10.0scarecrow-like transcription factor PAT1
RefseqXP_027064391.10.0scarecrow-like transcription factor PAT1
RefseqXP_027064392.10.0scarecrow-like transcription factor PAT1
RefseqXP_027170795.10.0scarecrow-like transcription factor PAT1
RefseqXP_027170796.10.0scarecrow-like transcription factor PAT1
RefseqXP_027170797.10.0scarecrow-like transcription factor PAT1
RefseqXP_027170798.10.0scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A068VEA10.0A0A068VEA1_COFCA; Uncharacterized protein
STRINGXP_009590821.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68124111
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Heyman J, et al.
    The heterodimeric transcription factor complex ERF115-PAT1 grants regeneration competence.
    Nat Plants, 2016. 2(11): p. 16165
    [PMID:27797356]