PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_10447_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family NF-YC
Protein Properties Length: 397aa    MW: 44822.1 Da    PI: 10.3807
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_10447_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC32.91.3e-102933771599
                                 NF-YC  15 dfknhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtd 87 
                                           +    ++P+ ri +i+k+ +  ++i+ ea  ++ ka e f+  ++  ++  a   +++ +  + ++++v++  
  cra_locus_10447_iso_1_len_1587_ver_3 293 NNVLYKFPMNRISRIIKSADINNKIAQEAVFVINKASEKFLELFSKEAYACAFLDHKNHVAYNHLSSVVSKRR 365
                                           3334689************999******************88888999************************* PP

                                 NF-YC  88 ifdflvdivprd 99 
                                            fdfl d vp++
  cra_locus_10447_iso_1_len_1587_ver_3 366 RFDFLSDFVPEK 377
                                           *********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008081.1E-12298361IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.102.5E-19299376IPR009072Histone-fold
SuperFamilySSF471134.19E-14313377IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MVGKQAIAVK TRSRKSSNLA NAKITSPKKG GNPSNASASG RKGTRRKPDE SEDSDIVIPS  60
SSPEPETDYE SKKEERNGKN QRATRKGADK QNGIKIKEAE ASLEKKKVNG ASSRVSEGNK  120
EHKKKLDKKP KGKEVDVKSP EKLNKKDDKI KADGKKGSTG KRQNEDNQED KRNEKRQKMK  180
LVEVEQQSNG AKKSRDDGQK EDKNQKTKGA DARKQRNGAN NRQDQGSKED KEDSKRQKKE  240
VAEVEKQMNE TKKKQNEGAK KEEQEKDEKK AKKKKNKEVE IETDDEEESN KSNNVLYKFP  300
MNRISRIIKS ADINNKIAQE AVFVINKASE KFLELFSKEA YACAFLDHKN HVAYNHLSSV  360
VSKRRRFDFL SDFVPEKVKG EAALAEMLKA ESSETET
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1170177KRNEKRQK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93041415