PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | cra_locus_10258_iso_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 177aa MW: 20678 Da PI: 10.6439 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 54 | 3.8e-17 | 2 | 46 | 4 | 48 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 WT eEd l+++++ +G g+W++ ar+ g++Rt+k+c++rw++yl cra_locus_10258_iso_1_len_528_ver_3 2 WTVEEDFTLINYIAHHGEGRWNSLARCAGLKRTGKSCRLRWLNYL 46 *******************************************97 PP | |||||||
2 | Myb_DNA-binding | 52.6 | 1e-16 | 52 | 95 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++ cra_locus_10258_iso_1_len_528_ver_3 52 RGNITLEEQLLILELHSRWGNR-WSKIAQHLP-GRTDNEIKNYWRT 95 7999******************.*********.***********96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.291 | 1 | 46 | IPR017930 | Myb domain |
SMART | SM00717 | 3.4E-10 | 1 | 48 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 3.26E-29 | 2 | 93 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.54E-10 | 2 | 46 | No hit | No description |
Pfam | PF00249 | 3.5E-15 | 2 | 46 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.4E-22 | 2 | 53 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 23.246 | 47 | 101 | IPR017930 | Myb domain |
SMART | SM00717 | 1.3E-14 | 51 | 99 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 2.1E-15 | 52 | 95 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.1E-23 | 54 | 100 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.87E-7 | 72 | 95 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
XWTVEEDFTL INYIAHHGEG RWNSLARCAG LKRTGKSCRL RWLNYLRPDV RRGNITLEEQ 60 LLILELHSRW GNRWSKIAQH LPGRTDNEIK NYWRTRVQKH AKQLKCDVNS KQFKDTMRYL 120 WMPRLVERIQ AAASASSSNN SSATATTTVP PPNSTIMSPN MNMDMTNNMQ QQQQQQX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 4e-23 | 2 | 93 | 30 | 120 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abiotic stress responses. Plays a regulatory role in tolerance to salt, cold, and drought stresses. Regulates positively the expression of genes involved in proline synthesis and transport, and genes involved in reactive oxygen species (ROS) scavenging such as peroxidase, superoxide dismutase and catalase during salt stress. Transactivates stress-related genes, including LEA3, RAB16A and DREB2A during salt stress. {ECO:0000269|PubMed:22301384}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by salt, cold and osmotic stresses, and abscisic acid (ABA). Down-regulated by salicylic acid (SA). {ECO:0000269|PubMed:22301384}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004239882.1 | 2e-97 | transcription factor MYB78-like | ||||
Refseq | XP_015075113.1 | 2e-97 | transcription factor MYB78 | ||||
Swissprot | Q10MB4 | 1e-85 | MYB2_ORYSJ; Transcription factor MYB2 | ||||
TrEMBL | A0A3Q7GN67 | 4e-96 | A0A3Q7GN67_SOLLC; Uncharacterized protein | ||||
STRING | Solyc05g053330.2.1 | 6e-97 | (Solanum lycopersicum) |
Publications ? help Back to Top | |||
---|---|---|---|
|