PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre17.g698233.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 929aa    MW: 85594.5 Da    PI: 6.1655
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre17.g698233.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP109.81.7e-34559634176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +C+vegC adl+ +++yh r+k+Ce+h k p+vl +g+ qrfCqqC+rfh l efD ++rsCr+ La+hn rr kk
  Cre17.g698233.t1.1 559 VCHVEGCYADLTGLRDYHLRYKICEFHLKVPSVLKDGVPQRFCQQCGRFHPLAEFDGSRRSCRTMLARHNMRRAKK 634
                         6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546953.77E-1326121IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.103.8E-1726122No hitNo description
PfamPF006514.0E-1327121IPR000210BTB/POZ domain
PROSITE profilePS5009712.6192995IPR000210BTB/POZ domain
SMARTSM002254.1E-929125IPR000210BTB/POZ domain
Gene3DG3DSA:4.10.1100.106.3E-30557621IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.35557634IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.28E-30559635IPR004333Transcription factor, SBP-box
PfamPF031108.5E-31560633IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 929 aa     Download sequence    Send to blast
MAAQCYIDLA RLLATGARSF SPHAAPLYSD ITLIAPDGRQ LKCHQMVLAA CSKRLATVLK  60
SGSFTGQKLP VQGVDSEALD TLIEAFYTGE CPLSLGSAVA VFDAAVKLEV NGLPAAVEEF  120
VGAALSPSNA VPLLQAALEA KTRRLVELCL GYVRSRLSEV VSGPEFTSCG LEAAAAITAD  180
VANHRHPPQL ALQVASAWLR GGGGGGAGGG GGGRLQLLPL MADQIGIGAD VLFTFMARQG  240
PGSPQLGGGG GGGGGGGGGG EGADGNNSSG SGGHGNGGGG GGGGGGGSNS INGVGGRGGG  300
GGGGGGGGGG QLSLLGEAQG LDGGGGGGGI ALSSLPLLQQ LLPGAAGQLQ LQQLTAAAAA  360
AAAGMDDGRG GGGGGEDGMG GGGGGGSDDR LAELRRELNS AVEAAGGGGG GGGGRGGGGG  420
GVGLGGGSTG VNGKRPRPEH EGLGSGWDHD TLGSLAARGL HGDMDLLGLG GGGGADGGGG  480
AGALALLGAG RGGGGGGSGP LSATPGLPAI GPAGGGGRGG LLSGPGPGGG GGGGGGLGDL  540
APPQLSSGRD RKSAGVKGVC HVEGCYADLT GLRDYHLRYK ICEFHLKVPS VLKDGVPQRF  600
CQQCGRFHPL AEFDGSRRSC RTMLARHNMR RAKKLGQVGS DPDDRDERDT RDTRERGRGR  660
GGRGGSAGNG TNSAGSPLGD DGGGGFGSAG SGGLDGLAGL GGLSGGGAGG LGGLPVLPGL  720
PVLGSLGGGG GGSGLLGGVG GDVERLGGPE GLAGLGLPEG MSLQDAVAAA MAASLPGGGG  780
GGGGGGGAGG GGGGAPGGLL AGRRLSELLD ELSGGGGGGG RGGGGGSAGG FGGGLSSAQV  840
GSLLEALTGA GAGDGVGGGG GGQGNFKLLG ASGMGGGGDG GGGLLGVSSA QQDAVAALAA  900
LGRAGGGGSG GGGGGADMSG ANGGGGMH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-215596331084squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1199213RGGGGGGAGGGGGGR
2433437KRPRP
3812826SGGGGGGGRGGGGGS
4818825GGRGGGGG
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre17.g698233.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3CNR50.0A0A2K3CNR5_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.12e-27squamosa promoter binding protein-like 3