PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre16.g692500.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 830aa    MW: 76192.7 Da    PI: 7.6963
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre16.g692500.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP82.75e-2664141178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv+gC   l++ak y rr+ vCe+h ka+ vl+sg + rfCqqC +f  l++f+ ++rsC+ r ++ n rrrk+++
  Cre16.g692500.t1.1  64 RCQVDGCGLPLADAKLYLRRYSVCEAHFKAEYVLLSGGRYRFCQQCNKFQPLDNFNGSRRSCKARSEDRNLRRRKQRT 141
                         6**************************************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-2660126IPR004333Transcription factor, SBP-box
PROSITE profilePS5114123.2962139IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.22E-2463143IPR004333Transcription factor, SBP-box
PfamPF031103.0E-2865138IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 830 aa     Download sequence    Send to blast
MQSSGDAYAL VAAAAAAAGL SGPGLVQDWR NPGGMGGEDP GYSDGDGDSS RKARKLRKPN  60
DIARCQVDGC GLPLADAKLY LRRYSVCEAH FKAEYVLLSG GRYRFCQQCN KFQPLDNFNG  120
SRRSCKARSE DRNLRRRKQR TDERAMQAGD GGSGGSASGG ADGILGAGIL RMVGSNGDDQ  180
TAAADALAAA VTGGLGAASI VGLGCGGGGG MSAALTAAAA SAMTGSNGTG GGGGGGGAIR  240
LTGKGANLGG LALPARAALD TNGVLKPLEP SQPADADVSA LAGNGGGSQA ALYAALQQLQ  300
ANGAIGGGGG GGMGVGMGMG GGCGMGGAAA GASVTAALAG LLSGGALGGG GSGGGNGLGG  360
NGLGGGLGNG GGGLTGSELV ALQALLGDGS SGISPSTVLQ LLTSATGGGG GGGGGLGVGG  420
APAGGLGLGG GGGPGLSLNR GNNGGAPLDR DLNLQVVQML LSQLDGNNGL AGSAGPGGGL  480
GAGLGGAGGL SALGLRLGDN GGGGAGGGGG LGTLGMQLVG GGNGTGGGGS TSVTAALASA  540
LSSLNGMNGL NGGFNGGLNG GLNGGLNGGL VGGLNGGHGS ALNGGLGGAL NGGLNGGALN  600
GGGNGSGALS VAGLLSALLG GGGGPAPATN SFNGLSNGLS NSLSNSLSNG LSNGLSNGLN  660
NGMVNGSGNS FSNGRSNGLT NGFGNGLSNG LGNGLSNGLG TGLSNGLAGL SQATLASLLA  720
QATGQSGGSG AGLVDGGGGG GYGGGGYGGG GGGGLGGGGG DSFVSAEVQS LLAQMGGGNN  780
AGGGGGGAAH HMLKSLNQQQ PQQQQQQPPY MLLSLDNLAL LQQQQQLQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-18651381184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130136DRNLRRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre16.g692500.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3CSF20.0A0A2K3CSF2_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.23e-19squamosa promoter binding protein-like 4