PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre10.g421550.t2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1756aa    MW: 173834 Da    PI: 7.1174
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre10.g421550.t2.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.26.1e-252651275
                        TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                 SBP 12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                        +  + y+rr+ vCe+h +a +v ++g++qrfCqqC++f el +fD +krsCr++Lakh +rrr 
  Cre10.g421550.t2.1  2 TAERPYYRRYSVCEAHIRALQVQHAGKTQRFCQQCGKFQELVDFDGDKRSCRTQLAKHSARRRL 65
                        56789*********************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114121.008166IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.5E-19353IPR004333Transcription factor, SBP-box
PfamPF031101.8E-23365IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.57E-20366IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1756 aa     Download sequence    Send to blast
MTAERPYYRR YSVCEAHIRA LQVQHAGKTQ RFCQQCGKFQ ELVDFDGDKR SCRTQLAKHS  60
ARRRLKLAAR RQQREQERQQ RLRQQDQGGG GSAAGACGGG DGSDAADEDD EGTEHHSEDE  120
HRADGGSTAG AAAASGAAAT AGRRGDESDD GSMDEDHGGL ASYDGAAARG RRHKASARDK  180
AAAAAAPAAA AAAAAAAAAA AAAAAAEVAE AGMRRAGARV AAGRNRSSKS RRRAEPPSTA  240
RTSSAEGKGD SKPAAEGGAS GMSAAAAATT APELRPARQG TRNRQARAAA LAAVAAMAKV  300
GQSSSSSSGG SSSDDADSAA EEEQQQQPSA TRRRVAAAVR SPARAMAPQA PQAPPPPSAA  360
TAAAAIPPMS IKRELADAAE ESYAAENAQG GLRSGSAGAA SPDAADEPAA APRLMTAGLA  420
IAAGTEVAAG SQPQQHVAAS AAAGQQPAQD RGGGAAAAAA VDTSAGSADA AADAAAGPAR  480
DAQQQQAHGG HGAAVVAVQE EPQQQPQSRF GPDVEREDGG GGGGDEMEVD GAAGATAAGA  540
GEGAGGKGED ASRKVQGGAS PFHSQQQQQQ QQQQQQQQQL REVRTAAASS GGRGGGVAGS  600
GGGGMSEHDV RLRLLGRLSS GAGTAPAATS SHPHPAPGLH LQPAQTTPML AAPGSAAAAA  660
PEATRSLADI GAAVRKRAAE QLRRYQQQER QQPLKASEQL QQQQQFNSAP GFGRGSRTSY  720
EAASVAGGSM SCGAVMGSAA TSGALYSALP DDLQLDLEIN SMLVELAAEQ VLMGQQRQQQ  780
RLRQMQQERL LPLLQQPSAH QPLSSGASDM EVSQTLSMEP AVGNITPSPA AAIALALRGA  840
GSSASGADAV GGLPATAVAA LSARLPTLPT SLIASPPASH QRLQTQLQAH GITLHLGALA  900
SPPPAAAAGG AGDASGASGG GGGTSGGSAR DARQQLQQQL GSAGAALMRQ TPRDAPAHTG  960
NASSPHGTGG SFAGQGCSAS ASIMAAASGR IIMPVAAGGL SSAGESSGYA QLMGSNLTSG  1020
PLLATKPVGD MSSAPAGFVR DARMSGLADI SAFTGSAVGA VGGGVGHPPR WGSAGDAVPV  1080
EAATAIPGMG RSGGGVDGFR AHTSTAGGAG GGGGGGGGGG GGGGGGGGGG GGHGLVPERL  1140
DDWRSLAASG AMAPSSLGGG GISNSLGASM GQRPASDGAA VFPLSLMRGG SSSGGSLTAL  1200
GSAPGGARRG GSGLSAGGSG ATAGGGGGGV LGLAGGRPGT RVELLQLDAV GATAAARQPA  1260
AEAGAGFGSM ILCELGATGG GDEGGGSGSF AGLTAYRQAA GGSSGGLLGS GARTSWLSGG  1320
VLAMDTDDGE GVPGGRAVAG ATDTRRGSGY GTDGVGSGAA GRMALQLQQQ LEQYGQQHGL  1380
PQDGAAPVGL RMQSQPQPQM QMQMLQRQAL PTPESSAAPS SVAPAAGSVP PFNSDPGTSN  1440
NIRRQMQLQL QLHQLAQQAQ HDQAVQQRAM QVQQAQQAQR RQAQLQQMQL RQAWQMQQQQ  1500
AQQQQAQLAQ QAAAQQPMPW ELEAALVQRF SIKMYGCSPE DLMPDAREQL EAWLRSQGLH  1560
VLQASARSGC VHIVADVVRM PPQQLAPAAD TAAEAAMAGR GPPGEPHGDA VGAGRSSSEG  1620
LYELLGGLVL QPGMAGSSSQ WQGDGGGCSS DGTSAGGDQR ISSRSGRAVL GLLQGLLGPR  1680
LGQKDTTTGS GSATHARPAG ADYEQQVAAG RVELQLGSQV IELTLHQLLQ AAAEVAKRPA  1740
GGPPLQQMQQ QRGCE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-131642083squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre10.g421550.t2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3D9830.0A0A2K3D983_CHLRE; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G15270.11e-14squamosa promoter binding protein-like 5