PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre09.g399289.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 983aa    MW: 95045 Da    PI: 6.5102
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre09.g399289.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP93.91.5e-29594671178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +C+v+gC+  l+ +++y++r+k+Ce+h k ++vl +g+ +rfCqqC+rfh l+efD ++rsCr+ L++h +rr k+++
  Cre09.g399289.t1.1 594 MCHVQGCNRSLAGLRDYYQRYKICEHHLKVSQVLKDGVPHRFCQQCGRFHPLTEFDGDRRSCRTMLQRHCHRRAKQKQ 671
                         6*************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.30.710.105.3E-1727134No hitNo description
SuperFamilySSF546959.42E-1328132IPR011333SKP1/BTB/POZ domain
PfamPF006512.0E-1231133IPR000210BTB/POZ domain
PROSITE profilePS5009710.34440107IPR000210BTB/POZ domain
SMARTSM002251.4E-840137IPR000210BTB/POZ domain
Gene3DG3DSA:4.10.1100.104.5E-28589656IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.897592669IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.71E-26594672IPR004333Transcription factor, SBP-box
PfamPF031107.3E-28595668IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 983 aa     Download sequence    Send to blast
MPILQLDRAG REREEPPCHL DLSKLIQAGT KSFFNNPLLS DIVLVCPDGR ALHCHSVILA  60
AASRRLAAAL KQGNWTPGQQ MPVKGVDSDA LETLVYAFYT AECPLELARV PALYDAAIKL  120
EVPSLAPALE QYTASALQPH NCCAVLELCL GAGVGPLAEL VLEWIRSRVA DVVPGPEFRA  180
CRLETAALIC KDLAGRSQLV GLQVAVAWLT ASSARGSLVG VFAEATGLAV DAIQAVANSG  240
GALGPIGGLG AAGGGGGGGA GAGGGGMSGL GGLGASLSLH GPHGPSISLQ LAVGGGGGGA  300
SDGLGPLGLG GGGGLGGAGV GGSGSQVLQL LPPPGGLGGG GGGPNDLSGL QSLLGGGPGG  360
LGGKAGAGMA GLGGLGGLGG LGPGLGLDAL ADAAEGERMQ KRLRLGAGGP GGFGALAESG  420
SATSRDLSSA LMDGPLRLGG GGPGRDLDLP SLSMGGVGLG GGGLGGGLGT SSGLSGGNGG  480
GGGVGGGRGR GRGGGRRRRG TSASDDDEDY APGGGRSGGS GGRSRAQELV YDADAAAMDD  540
PAAGSGGGGS GPGEDAPSGG HGDDSGAGGG GGGNIPANTP VLMTGRRTPA QKGMCHVQGC  600
NRSLAGLRDY YQRYKICEHH LKVSQVLKDG VPHRFCQQCG RFHPLTEFDG DRRSCRTMLQ  660
RHCHRRAKQK QELAEVLAQR YEEKQVAASM TAVMAAMARG TPAGVPALPP MLQLQYLAGL  720
PAAAAAAAGR DDGGAKDEDM DGRGGGGRSL PAGLHSPPSR AALTEAVQQR ARKQQATVLS  780
QSGLLGLAGS GEGLPEGQLA AAMAAAAAGL TLGLDNLPAV GQLPGSGGVA ERKFGDQELL  840
TGGGGNGKEE QRAGAAGAGS PPSAAAAGRR AGGEEPASGK HEPADTEGVG GGGGAGDSGE  900
DGNGSRPATG GRFAAASKGE PGGGSGDGLQ RVDGGGDSPG GNGAGAVGAQ WGAGDAAACG  960
ARGGRDAAVP SGLDGRSQPR DL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-175946681084squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre09.g399289.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001694726.11e-141predicted protein, partial
TrEMBLA0A2K3DEV50.0A0A2K3DEV5_CHLRE; Uncharacterized protein
STRINGEDP023101e-140(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-20SBP family protein