PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre09.g390023.t1.1
Common NameCHLREDRAFT_195928, CRR1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1233aa    MW: 127183 Da    PI: 7.4683
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre09.g390023.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.52.5e-35438515178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv+gC +dl+++keyh+r+++C+vh k ++vl +g+ qrfCqqC+rfh+l+ fD +++sCr++L+khn+rrr++++
  Cre09.g390023.t1.1 438 VCQVPGCGKDLTNLKEYHQRYRICDVHIKLQQVLKDGRLQRFCQQCGRFHDLTAFDGNRKSCRDQLSKHNARRRRRAQ 515
                         6*************************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-29435500IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.547436513IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.97E-31437514IPR004333Transcription factor, SBP-box
PfamPF031108.0E-30439512IPR004333Transcription factor, SBP-box
SuperFamilySSF484032.49E-119191069IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.202.1E-109511087IPR020683Ankyrin repeat-containing domain
CDDcd002042.94E-109661062No hitNo description
PROSITE profilePS5029712.79701088IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1233 aa     Download sequence    Send to blast
MASDLANIFN DEEAGSDRAN SITSSDLDPF LLQGDDQTWA VEDWNWDPFN MFAAPKETPN  60
VACCQALKRR KVTEQSATSA PQQAAQQHHQ HAACQPCHGA SGSRAGPPAA PTAACCSMAP  120
GVQQHAPAPA PAQQLTGPLQ TALNSMMPGQ QQQRVADACG VSNMCHAPGM VAPPPPMPVA  180
APLAATGHQA GGMGMGHMNP AMGHMGWPAM PDMSNPAAAA AAAAAAASFF PTMGAGGRGP  240
LATMGWGAQP MALQMPSMGL PGFPGGHTQC APALQMPAVA FPTPSSGIFH QQASMAVPPS  300
ALPSPALGCS GDTTSLQGSA DNCAKPPCCS GNRATGPTCS GGRQQADSSN KAAPPPPKQP  360
AQNTVGARGG AAAPAPGDLS DFNISDSEDD DEVARRPSAA GTQRGGVGNA AALNAAAYAN  420
LGDIVSLQDV GDDTGAMVCQ VPGCGKDLTN LKEYHQRYRI CDVHIKLQQV LKDGRLQRFC  480
QQCGRFHDLT AFDGNRKSCR DQLSKHNARR RRRAQAEQAK GRAAAQEAAV AAAGAMAAAA  540
AVGGAAGGAP AVPGFEGGDV GKLLACLMQN PTQLHALRLL LGVPTHPALP AAAPAAGLGM  600
AAGGDTAAQP DQARTYGLAR DILAGRNEFS PAFESEHRMI RLSMKLFNKT PADLPHDLRN  660
QVTSWLASAP LAMEASIRPG CVFLTVQMLV DEAGAQQAAA PGALHGLVEH LLTRTGCPFW  720
HMGMYTVQMG TDMLLVRDGK MAGDANVNAS GAAAPAATGE GAEAAARVRG DGRFPVVRRL  780
GPLAAVAGQP TVLKLHGLNL DAPGCSVILR WGNKHLKAHM QALSTHRAIV RLPPLPDLCG  840
PVWVEVARGA YLSPAKQLLV ARNEELVQEI NKLDVKTGPL RHDTVELLLQ DLALVLQHIA  900
AQPGVAAQLQ HAVIALKARR LLAMACDMGW AAVASAVLPL ACARCSCASE MVAAIHSAST  960
PSQTGAADKR GLTLLHRAVR SGSVSLLAGM LAWGDSHGYR WRVDAEGPAG ITPLHLSAML  1020
DDARIGLLLL DHCGWPAAFT HLRSDGGVTP FHLAFQMGHY QVDALMSALG GLHQVADPNN  1080
AAAINNAAAA AAAAMSPSRR SRCGNAAAMG CKPDPDEDVK PDLAALQRGG RNGGGGSGGC  1140
TELDPCENCH CTLPPLLLSI MASCTDCGRR RMCMETECNN AAQRCGDCGC GGARPTARVD  1200
SGEVCSSRQH GTIFSITALC QGCHANRTLA VA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-21434512684squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
111281135GGRNGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.89480.0normal conditions| nutrient deficiency
Function -- GeneRIF ? help Back to Top
  1. Crr1 is involved in the transcriptional regulation of the FDX5 gene in the absence of oxygen or copper.
    [PMID: 20833896]
  2. Data show that activated HSF1 and CRR1 transcription factors mediate the acetylation of histones H3/4, nucleosome eviction, remodeling of the H3K4 mono- and dimethylation marks, and transcription initiation/elongation.
    [PMID: 21705643]
  3. These combined results prove that CRR1 is involved in HYDA1 promoter activation.
    [PMID: 22669892]
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre09.g390023.t1.1
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ1542600.0DQ154260.1 Chlamydomonas reinhardtii copper responsive regulator 1 (CRR1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001694940.10.0copper responsive regulator 1
TrEMBLQ50H720.0Q50H72_CHLRE; Copper responsive regulator 1
STRINGEDP020920.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP550058
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-20SBP family protein
Publications ? help Back to Top
  1. Kropat J, et al.
    A regulator of nutritional copper signaling in Chlamydomonas is an SBP domain protein that recognizes the GTAC core of copper response element.
    Proc. Natl. Acad. Sci. U.S.A., 2005. 102(51): p. 18730-5
    [PMID:16352720]
  2. Merchant SS, et al.
    The Chlamydomonas genome reveals the evolution of key animal and plant functions.
    Science, 2007. 318(5848): p. 245-50
    [PMID:17932292]
  3. Lambertz C,Hemschemeier A,Happe T
    Anaerobic expression of the ferredoxin-encoding FDX5 gene of Chlamydomonas reinhardtii is regulated by the Crr1 transcription factor.
    Eukaryotic Cell, 2010. 9(11): p. 1747-54
    [PMID:20833896]
  4. Strenkert D,Schmollinger S,Sommer F,Schulz-Raffelt M,Schroda M
    Transcription factor-dependent chromatin remodeling at heat shock and copper-responsive promoters in Chlamydomonas reinhardtii.
    Plant Cell, 2011. 23(6): p. 2285-301
    [PMID:21705643]
  5. Pape M,Lambertz C,Happe T,Hemschemeier A
    Differential expression of the Chlamydomonas [FeFe]-hydrogenase-encoding HYDA1 gene is regulated by the copper response regulator1.
    Plant Physiol., 2012. 159(4): p. 1700-12
    [PMID:22669892]