PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre07.g345050.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 530aa    MW: 52112.6 Da    PI: 6.6048
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre07.g345050.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP114.36.8e-36206282278
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         C+vegC++dl++a  y++r++ Ce h kap ++ +g++qrfCqqC+rfhelsefD++krsCr rL++hn+rrrk+++
  Cre07.g345050.t1.2 206 CHVEGCTVDLASAGPYYQRYRTCELHLKAPYIIKDGMQQRFCQQCGRFHELSEFDNNKRSCRARLHSHNQRRRKRTE 282
                         **************************************************************************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.7E-29200267IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.162203280IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-31205285IPR004333Transcription factor, SBP-box
PfamPF031102.9E-31206279IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0010358Biological Processleaf shaping
GO:0042127Biological Processregulation of cell proliferation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 530 aa     Download sequence    Send to blast
MHYPGMQSAG DAINSADTQN LIASIADILQ GTTAAIPPGP PLGGPTPAGA GGSPGRAAAD  60
AANAAAAAAA AASAMPNGLM LLPHQLGGIP GFPGINLNDP NLAPYLQLAS MGASGLAMDP  120
SLQQLMFAMP GQPGGLPLNS LASLLVGTGV ELDPSAAADL AAGGLMGGGK QGQLAGQKRP  180
ADMAAGGAYK RERSEEAGRG REQGKCHVEG CTVDLASAGP YYQRYRTCEL HLKAPYIIKD  240
GMQQRFCQQC GRFHELSEFD NNKRSCRARL HSHNQRRRKR TEEQMANQGA DGAGGGGHGG  300
GAASGSLQAG GGLMQPGAAA NLGAQMAALG AHGLLGGVGA GAPNLNDILN SMGGITPDLL  360
ASMTDPTKVA PGDLAALLSM SPALLGSLGM GAPDANAALS LALAAAGGGA DALGQPLLDS  420
IFKGAGGGAP GGGLAPGDLA GMDLQQQLAM ALAGTGGAMP DQASMEAALA AAAAAMDPHA  480
LAAAAAAAGM SHHQLAGLGH HHHHQQHHHH DPMGGGGHHL GGHHGDGSM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-252062791184squamosa promoter binding protein-like 4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre07.g345050.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DKY10.0A0A2K3DKY1_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-29squamosa promoter binding protein-like 3