PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre07.g335150.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1406aa    MW: 140700 Da    PI: 8.4476
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre07.g335150.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP84.71.2e-2625100176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +C+ve+C  dl++a + h+r+++C++h kapvv+v+g++ rfCqqCsrfh ++ef+ + r+Cr  Lak  +r+r +
  Cre07.g335150.t1.1  25 RCKVEQCGIDLKSAPKTHQRFRLCNTHIKAPVVVVDGVHSRFCQQCSRFHPVDEFNGTNRTCRMMLAKNRARQRST 100
                         6******************************************************************988887765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-262187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114122.96523100IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-2524101IPR004333Transcription factor, SBP-box
PfamPF031105.1E-272699IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1406 aa     Download sequence    Send to blast
MDLPSITTRR DVIDETTKRV SPPLRCKVEQ CGIDLKSAPK THQRFRLCNT HIKAPVVVVD  60
GVHSRFCQQC SRFHPVDEFN GTNRTCRMML AKNRARQRST TSGPGSGGRS AFGRRSMQSD  120
EEDEELSDLS DSGSDERGGT ATRKGGKAGG AGGRASSSGK AASGGNKSGG ATAAGAVAAS  180
AAAVNSQPLG VQPPTLLRRL SAAGGAGWGN SGNGSGALGA LAPGGPLGAA VVGGVGPSGT  240
SSIAAASQQA GEAQALLGQG HQGPAPMELG GGGGANGSHH AGHGRHALLG HLGLGDGTGG  300
TGAGMFARSS APPELGAGNR AAGGWNGLDN QRHQQQLQHV QQQQPLPYRP AYLEPQLLQQ  360
RQQQHHQQHE RYQMQQALQQ QQQQQREERQ LQQQQQQQQQ QQQQQRQQHV VSGGAGYVQG  420
PHSGGQVLGD FGSGVGTRSG NYGAGGAPQG DGVSLAQQQQ YGAHAPQHGH AHVSPFAARP  480
GMTAATGASA ASSPQVVEYH RPLSVTAVAG GMGGEGGGGG GGGSGHVPFL YNAGVTGAGA  540
GGGASMFARM SAPVSATSPL LRPMGGRGPG GVSGGGAGGP QAVAAALMGR NSLAGSLVRV  600
ESIKRRRSGD GMGVAEEQRL LEQEGAPSPA IRHCSSSGVR EPMLDGALQT AGSTGSGLGS  660
GLGSGLGSNS AFQRASLLQL QLQLQQLQQR AATTGGIGLP MDARLLPGGA SGPSQGTGVS  720
LAAPGADVGG LRGGAAAAAG ATGLQSEAAL NAALTALSAQ QQALMQQQQH QRELQAMLQQ  780
QQYQLQQLMQ EQDVEPEPST SAASAGSNDS PACGAMSGIG GVLQSVAAAA AAGEELRTVA  840
LRRSHHQRNA SGGSASLAQA AVAAAAQRSS GATTPAGPTT AVLMIAANGS RPMTPRCEAA  900
ACLGALALGD GGGGGSGLGS AGPGSAGPGS AGPGSANVAT GSVGAAVPAG VVNEDEGLAA  960
LAAKWRREAE EGNSLQAQAA RQAQRYAAGQ PVKTEPDGLG VGGGVGPAGP LLQPPAGTMT  1020
GAMQPAALGG FAAPVAGGAA GGFVCGPDGK LEHGSEGCSG ADPARPQIAT ALTPGMAGGA  1080
HGAAQAIGVH GRNGVAGLYP GGGAGALDAA QGDGGYLRTT QSEPAWANPS GAPHMQLQPQ  1140
QQQYGLAQPQ QLSVGAGPRP QLQQQQQLLR NSMLRSSSPL GPGGPSFARS SGGGVGAPSG  1200
LGMASAQQHW GLQRLGGGMS GMAEGPGDGK KAVGEETEEQ LQLLLSDLFG GQGSAGGPGG  1260
HRAAAAQAAQ HTADGMPAMQ LQRQYQQHQQ QPLLSEHQQE QDLQQQDLQQ LGIARERQRR  1320
LWADLQALQA QHEQLQQALL AGQANGTHDA QLVALLQQQS GALETQRAQA AAGEEMLHRM  1380
EAEIMAAAQQ RQQQGGGPGM QWSKQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-1626981183squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre07.g335150.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DK760.0A0A2K3DK76_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-19squamosa promoter binding protein-like 3