PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre07.g325738.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1982aa    MW: 197762 Da    PI: 6.3557
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre07.g325738.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP76.54.4e-24101176277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         C+v gC   l+ +k+y+ r +vCe+h +ap+vlv+g+  rfCqqC+++ ++ ef+ +k+sC   L++hn+r r k 
  Cre07.g325738.t1.1 101 CEVTGCGLCLEGLKRYYIRMRVCEKHLHAPAVLVNGTISRFCQQCGKWQAVAEFEGSKKSCIATLERHNARHRAKV 176
                         ***********************************************************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114121.58998175IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.101.4E-2299161IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.76E-2399175IPR004333Transcription factor, SBP-box
PfamPF031103.5E-26101174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1982 aa     Download sequence    Send to blast
MSGRPRKRVE EEAAAEEAWT LDNYAWDPQQ CVARKRTKTT EGHSAQAVFG AHSYLEGSGK  60
AAMLAAGSQL LQQQLSAVPC IEPLPELITV NPEECDPATH CEVTGCGLCL EGLKRYYIRM  120
RVCEKHLHAP AVLVNGTISR FCQQCGKWQA VAEFEGSKKS CIATLERHNA RHRAKVQARL  180
AEQQTRGGAA AAEKAAAKAA KSAAAAATGG AKRRSGSAAP KGRAAAAAPS TSGASGGSAA  240
GNSDNAKSSF GMADLMGTAA SAFAAGGLMP YPPAMDNGGT TNLLQPTFGP WDAAGGANGA  300
GGASSGAGGA SSGAGGLPMR PPITTGLAGA GAGSAGNGVS LAGSGRLGSV EVTGGFVRLP  360
QQQQQEQQQL LLPMLMSQEG VEIDRALHAP PHDAFRRASS MNLSQQQPLL LKPPQPPEDV  420
RMALGAVKQE LLLTQPPALA GANAPPPGAW RQGYPMGGPA AGTYDSGLHG YAGSGGYAST  480
YPARMGSGMP GGPFGGGAQH AQHGYSQPYD GHSTPGHMQF GGGYPPQAAA GYPPHAQHQD  540
QFQFQQHHMQ QQQQPYLHMH QQNVHQHQQV QGYPANSPFP AQQQHTSYAA TPQQNQGTLF  600
PQQQYQQQYQ YQHQQGAAPA AAGNDASFNH ATTGSRGSAP SAATAGAMPG GGATGAATGA  660
TPNASSGSDT SGVQSQATAR QAMAAAAAAA AAASGGAPQP RGSSGTAASG ASGSAFANSH  720
GGGSAAAAVG AGAGAGGAAA MSDSGALATR LNNVMAELST LVAQVAHLQQ PPPPALAAPA  780
AGQALPARND SAPADMPLPL RLPAMAAVDA ADAAAGTAGH SPRSVSAQSA PTRPGSDAVT  840
SSARAGSSSL SPIMDAALAM MSQVSELAAA LQPGAEPGAA ALAPQQQPGF RPAMWAVTTG  900
MPAAVQSQPQ QQQMLQQPGS GSSGWGSQQQ PQPHQQHLGE MAASSAAAKP FPTEFTAAGP  960
GFVVSTGYPG SSSGNGSGGG AAPSSNGNGS ASASQQQAWI PPQSISAPYV PSAAPGQQQS  1020
LPPAFAGAAA AQTPYSAASH ADSPSTTVSG SAAPSPTQPQ PQVQPQSLHP GGGAAADAKP  1080
GDVSAAAAAA AFAPDADGDD LDEQLLGELF DYLEEENGAA AAAAAAAATA AGSGHATIAV  1140
AAQQAVGNYQ QTMAAQPYPL PAASLAPPPA AAAGGAMAAP PPLVEDDVDE REFTRVSLKA  1200
MNVLPHELPP SLRANLRRWL RESRAEALQA TLRPGCLQLV VDVARSLRTP AGAPVSGDLA  1260
SVLIPPHDAD QAAADVFRIL GQRLRDTYVQ VGRQVLQIRV GERPIVLSWE QAAEDGGLDN  1320
ARFPELFTCS APAVCAGADV SLELTGKHLC HPSTKAFARL RGHDLPAARL PNPSPPASPS  1380
DPATSFPSTS EPEAGTEADK AAGSSRADPA TSSGSLLRVR VQLPAGAVGL MVVEAGVGHL  1440
LGGWWPVLVL PAGRDAAAAE LGELSTQAQE AARAEAKAAS EEAAAAPAPG GTAKRGFERL  1500
VRDLASVLET HADVCASTSP SSSAHATSTA TPASPPDTAT GASSSSPHVA RSAAGATSPG  1560
AAQPSGSTHT RSSGDGTVDA STTAASAAGW SMYTTDTLTG TTGAGSTVAS TLHTLTTTTT  1620
TGPRGGAAHH GGAHAAGAVG AGGFPGAGTA HAGAPVRLSS PTHSVDGAAA APARAAPVVE  1680
PTADAVRKAL ARSARLLRYT IARGRPHLTA LLLEAAHGLA AFPGALPAAA AAQSASAFMA  1740
AGIDLQALLP LAVLSGSVAT VDVMVGFAAA VLRAPLRLDL PHGPAGLSAL HLSALLRDGG  1800
VMASHLVASQ PWAAWSWVCL GWQPPSEGPR APAAATAAAG AAAGAGTESA AEKEEVVAKA  1860
EDKEGGDGAE KEAGEEEAEA DEEEEEAEEE EEDLLAPVPL PTKLTPGALC VLLGQTAPLQ  1920
RALALVQQAG QRRRLAAAGA ASGSPGESDV TAALVGAVQA WGRTGAALMA ALCEQLARQR  1980
L*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre07.g325738.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DJE70.0A0A2K3DJE7_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-17squamosa promoter binding protein-like 2