PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g300600.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1779aa    MW: 179831 Da    PI: 7.4366
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g300600.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP109.12.9e-34100176177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +CqvegC +dl++ k+y++r++vCe h k  + +v+g+  rfCqqC+rfhel+efD +krsCr rL +hn+rrrk+ 
  Cre06.g300600.t1.1 100 VCQVEGCGHDLTTEKSYYQRYRVCEPHLKLLSLMVDGKPCRFCQQCGRFHELNEFDGNKRSCRARLIQHNARRRKRD 176
                         6*************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-3097162IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.06898175IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.09E-3099176IPR004333Transcription factor, SBP-box
PfamPF031107.1E-31101174IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1779 aa     Download sequence    Send to blast
MDVFNSGFQH TAGNLQQQLQ QQQQPQQWSG QQFQWDSQRL TAYPLGSGSP SGSSPSEGHG  60
DSSSGHREQS LGPVPMGWPQ GSLPGSGGRE QRARLKGPLV CQVEGCGHDL TTEKSYYQRY  120
RVCEPHLKLL SLMVDGKPCR FCQQCGRFHE LNEFDGNKRS CRARLIQHNA RRRKRDPLDT  180
SGNASSGRRQ QRRMVLALPN SDSSGDAMHG GVGAGGAGAG GGNGSGDLSN SGMPLAPGLG  240
GLDQGHERLG GIRINANFLP QAHGTAGVLG GGGGVLGGGG GSAGGGWPQQ QRPLGPLPMG  300
LPGSHSMLGE AHQPLQPLRL RALDHDLGGI MGGGVGMADG GANGGNPGPF TAMLQADGAG  360
GLLHPNDQLP PLQSQNARQQ QGAFESLALP LLAPRQQGSY QPMSTGHSGG PVPSPPLEQQ  420
PPHPHQHPQH LQHPQQYPRP HPQQHSQQHP QQQQHQQHHA GQPGPRSGPQ TSGHLSHQQQ  480
HQPQYPQQQR QLQPGGGPGV SGLPYSQGPS YPGSRSQASN DGVRSFADVP DFLAGGAGPG  540
YQQQHPHQQP YHNGPGGGAP MGGAGGPGGP GGGPFDEYVI DALLGTDNGC GGEVHVDDPR  600
MPLANFADVR NSFTRRAGVE AAAAGDGGMG AAMLPPSGGS HGHGHYHMRT SSTSGAASVG  660
AAPAASMHGG GQSLSDSQAP LPQSYSQQRG SPNTNSQLHL QQQQQHMQSG GSGGPPYHIQ  720
GYHDPYNPTF QGPRRSGGVG AVHGHGHGSA QLTASAADCG VTGGGFTNAS TLSLASNSSA  780
WAPFDSNTNN HVVSGAAMAG GSGVLPGGSG PLHSGVCGPA SGALGYNNNP GPSGAGGYGA  840
GGHGHSSGGG GGSFEAARRL VSEGGAAAAF VVPPDMLARV SMKIANCTPQ DLPPDLYDRL  900
CNLLRTADAS LVQGFLRPGC THLVLDVLVR PTAASGPDGA AAADADATST AALDPVALRD  960
ALGPELLAHS AVLVQTEEEV CLWPAAAPPG CEPPNLGSVS ELQAAGELPV LDAVSAAAHV  1020
PPYADAAAAS STGTGAGTDT SAGTVLVAYG RNLAAEGVHL FARCQGGYLP LTVTPLVVGG  1080
QVSREVGSSP QLAAAAAAAS RSLAALARAG RPATDALLVT VREAPGTGLL LLEAQAGPLL  1140
SNWRPCLLST DATIAAELSE AGCRALRHGA NALANLEAFV TDLGRLLDLR SYVYEPPTAA  1200
AGGSEDADGY EGEDDCSAAG GSSAHTGSCT AATASTGTGT GASCATSAYG AAPVSVLDLV  1260
CLCERLVGWS TDAGLAAIST FLVSALRSDY RQDMQSVLEA PYNDGSSVVV RCLRSGSAAT  1320
VRAMLGWAAA SGVSINWSAP AAPGAGAAAG LSPLHVAAVV PATWRLLAEL PEAKKLWAAA  1380
RARRDGATPL HLQRMMLATL PPDQIRALSE AFAAPRAAAP VPAASAAGAA PASVAAVAAE  1440
PAAGAAAHVA ATPDPRRSLT SSPKTSLRSR MAPEVTPVAP TPSTSCSCSG AAPATPYSSS  1500
AAAAAAGGGS AGSGAVVYPP VVPFVAALAL IALAALASSS EASYVAAAAV AAALCYSLHT  1560
LRALSRAPSH RAFVSSLGSR LLPHFAHPHL ETEYAEHRRA SLAPLDMAGV SAVLLVCCGS  1620
ALGSGGGAAQ NLVAAVNVTL TLLPLLVLQA APKPFYARNR CLLLVGPYVA LFNVVCGVSQ  1680
ASCSSPVALY GASLALASLL LPVNTAAMLL IMAYTAMHGV RGVLRRGLGW PPSEACASAQ  1740
MAVVAAVAMV VYARELAVRQ AWVVRAAAQR KVRANKQA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-2197174784squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g300600.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DQX40.0A0A2K3DQX4_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-24squamosa promoter binding protein-like 4