PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre06.g278229.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 2441aa    MW: 242436 Da    PI: 6.4783
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre06.g278229.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP86.33.7e-271488175
                        --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                 SBP  1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                        +C+v+gC+  +++ k+y+rr+ vCe h +a + lv+g++qrfCqqC++f +++efD+ krsCr++La+h  rrr 
  Cre06.g278229.t1.1 14 ICKVQGCTRRMQNEKQYYRRYGVCENHLRALELLVDGRMQRFCQQCGKFQDITEFDDVKRSCRTQLARHSLRRRI 88
                        5***********************************************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-25876IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.1531289IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.49E-241389IPR004333Transcription factor, SBP-box
PfamPF031101.1E-261587IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 2441 aa     Download sequence    Send to blast
MNEGPAGGGD QVQICKVQGC TRRMQNEKQY YRRYGVCENH LRALELLVDG RMQRFCQQCG  60
KFQDITEFDD VKRSCRTQLA RHSLRRRIKL SQRRQQQQQQ HDDDDNMDTD EGVAGGGGEL  120
ATGGMGNTER TAGAAVAAGG REGEAAILQQ LQQLQQQTDL QLLATGAAAV NAAGAGSWQL  180
GATSVTAAGA GTAAAVAAAG GGALDLGQWL PSAVGSPQLP GGSATGRAAG ASGTLTAAGA  240
GAGTADGSGS GFFLDLAAAP GTDLQQQPQQ SQQRRISLAL GCGSSVDVGG GLLPDDAAPV  300
RLVAPQLLAT QQERQKTSAD GGLVSITRRR SRGSNSGTGP FTADGSAGLT PIAAAAAAAA  360
TTATASGSSQ QHGATGTGAR TFAHVAMYSD TLPPAASGPP VAAAVSGAAG PQQRPLPGTV  420
AGGASLSAAA DGLDAGRNRK GHVRLADVCD VAELEVAVGV PALHSGASGG GPAAGAVGVT  480
LAAAAAAAGG THVPVQVGVV NMQQPLSRQL NPQQFSLHHQ QQNPQQQEQP SPFSLPPGAT  540
HHSLGMHQQL QPPLPPPQQQ PLLRNQQDTS QHQHSHQQAA QQQAALAAQM AQHAFSANPA  600
FHVPQETEAW ASSQSGSAML RSGSGGGGDM VRGASGSFSV GGAPTIVGAF LSRQQEVIAS  660
QQLSLAAVTQ RQQLQGPITY QPPHGGSAVG GLPAGPNSGS AAAGGAAGAT AGAAATAAAA  720
ATAATAATAG AAATAAAAAP SPVAQRLNQF SAVQEILTQR LAEQSIVRDE RLDSELNTLL  780
DELAAEQERE EMRMLRQRQQ LHQQQLRQHQ QQQQQLLLMH QQQHQQQDRR SSNATTAYGS  840
TSSGSAAGGR VLLSAAAAAV ALAATGISSG PPAWASSSAA STSNGSAGAT SGSGPTSGSD  900
HLTAGPAPLA SSGSEMPLRF LQQQQQQQQQ QQQQQQQQHH QQLLQAPQQQ LLHALQPQQQ  960
EMGGLVSGLP PLLVGMQQQQ QQQQQQQQQQ VPSLSFGAMP PPSALPAARA APMAAGITAR  1020
TALPPLQAPM QQQLHAAPGS SGGGMPYGAQ QPLWLLQQQA DPSAAAATAT GAAPNMQRQP  1080
LMINAGSSAG PPYSVQGMGL SGGGNNAILA PGAGGGGVRC GPSGAPSGSD SGPAPHTPLL  1140
TDDLHHLHSA PPMNNDGRGD GNGNGKRSEA AAAGDLGGWA HIMAAAEAWG ADEQQQQPQP  1200
QLERQVVSAQ GHQVSEALQR APGVNMDGSR AGADDDSERA RVRPRWGYAQ QPQGGGAPST  1260
TVRNAATDTT AAPVRYGVAA SLTGSGMPPP PLPPWEGGGV GMAAQPAAVG GGAAAAVITD  1320
AAAAAAAAGM PAAAAAYEPV HVLRRLSLKL YGCSPADLMP DTRQRLAAWL ASMDLALMQL  1380
TVRTGCAHLV MDVLAGGRPA AGRRAGGGGG GDAAVASRQP TPPSSTSSPA AQTDASDRSP  1440
SSEASPPSAA GHAVVAAAAE IAGAASSAVG MSSVAAGGAD GGAAVTPAAA AVTAALVMGM  1500
FEEARAHGSS SGSSSSARSL RGLLLGTSPA NAPPPRPRHQ PPQPAVDGAS AAPGHTFTAT  1560
SPSPAPGSYA TAATPAGVAG AAAVLSPPRP AAVAGRPPSL MSSSSIGTGG TVATGRHGGS  1620
STASGGVSSS GMAQSVMMMV SDSPEGSAAR VRELYGYRGS NEYRPPGGGT GGDTSRAAMS  1680
GGNRQSGSCR STAAAEGTST EVAPGGAVRP TGTLMQQLRA RDGGSGSVFQ IGSPASDDPS  1740
PPAPPPSLAA EVPLVPSLST PLEQQQPQAA GDDLGVAGGH VAASRPQPME GLVAASAAAI  1800
MRALRDSDEH TPMASPAASV QQPAPTATTT DNTAGAHDAG SGAAAAAAPT TPGWAEAQGR  1860
ALLRLLALAA AGPSQAAGGV DTLSPDDSPG SAAGGVAGGG EVAAAAAQQQ AALTRLLQDL  1920
LGPRWGEPGD EGQEACVGHR VMLQLENQAL CWVQPPSQSR LEFQAVLPQL LPAAPLTAAP  1980
SQQARREVAP VAPPPSPTPE PTPPALVLSV MPPAVIAGGV SPPCVVVTLL GSEGPYSPFS  2040
LKHGTPIYRE GTGLLPASDT EVTEPPVVPL TPSSAAGGGA AAAGRRRQSP LMPPLPAAQL  2100
HVRQGGEPLL SCQLASLPLR RVALIPASPK PAAEAVAPPA PPAGATLPIL LQGLTLTDES  2160
EPPPSLNAAA QPTRAPVGGR RYTAADYPLS RLASSSLDPG VVHSVAAAAS SSRSDPADPG  2220
PPGAAPAVAT ERHHASTAVA VSLTLPPLAA AGLAVIECSS GDMLGGWQPL VVLPAAFPGA  2280
AAAAAELSAL VAAAEAAAEA AEAAAGRTSA PAAPGGGPAP HKHPTDGVAD LTSAAPEAAV  2340
AATPATAAVA VAAVGGAAGV RDFLVDLGRL LQLGAAAAPL EALGYTDDWA AYEAYAEAKA  2400
AMPDAVLTAG RVLRQCMAWR LPSCTALAAS LMLDFAQVPQ *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-22687283squamosa promoter binding protein-like 4
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre06.g278229.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DP940.0A0A2K3DP94_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.21e-19squamosa promoter binding protein-like 4