PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre04.g212700.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1931aa    MW: 191775 Da    PI: 6.1753
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre04.g212700.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP82.94.4e-2645120176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +Cqv gC++ l ++k y++rh vC++h+  pvv+++g+e rfCqqC++f +l+ fD + rsCr rL + n  ++k+
  Cre04.g212700.t1.1  45 RCQVAGCAESLLDCKPYFKRHLVCQTHAILPVVVLDGVEMRFCQQCAKFERLTAFDSGNRSCRFRLTRRNLAKQKS 120
                         6*********************************************************************988886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.1E-2440107IPR004333Transcription factor, SBP-box
PROSITE profilePS5114122.77743120IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.96E-2444120IPR004333Transcription factor, SBP-box
PfamPF031104.3E-2346119IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1931 aa     Download sequence    Send to blast
MDGEAQVIHS WDATSTLWNP LTLDSQAVGA GSAPNSRGRR GSGARCQVAG CAESLLDCKP  60
YFKRHLVCQT HAILPVVVLD GVEMRFCQQC AKFERLTAFD SGNRSCRFRL TRRNLAKQKS  120
LQAKAAAAQA GGGGAGAAGQ SPDVACGKAR GGSSSELQGS GSSEGRDTRS NDADPEPSSQ  180
RRNTHGTSAP SPSSKRTRLS SEPKSCMAAH ASGSALQDES HADSRTPVPS HNTHSVGDVT  240
DFAADALAPF ASALRLDGAP RAPTSLTAAA AAGAAAAGVA AAPAGMEVAA AGIAAPQWAA  300
AMQTQQHLLQ PQQLPQQQQQ LTQPQRPQAQ QLLQVPPQQL VPGLLGLRPN REEPYVTLAQ  360
APPVSEEAAA AADAAAGATG MGSGGRGFGG RSSGNRGFGG TGAAAAQQHV LNDYDAPGVG  420
ACRSPFGDTD LSALMQQQHQ RHQQQHQQHQ QQSRARTGLG PRAAALALAG CSGTLKAARA  480
ASMDASIATA LKSLCQRPGL SHSERVALES LLGLMQGCGG GGRGGSSGGL TLPPMADGVA  540
LDSQLEDIMT DVLHDDSGWC QELLASPVTA PTHAASAPAT WATAYLGLDG ANGMPGYPTL  600
PGGQGNYPPG GLASTRDSTT GVLQPGGAVR DAAGMRPHAQ PQWLAQQQQQ QLQQQQQQQQ  660
QQQAITMTDG SWGSADPAGS SGAHGRLHVS SVHCAVGPMV PIMHGSFGGA AAIPAATNLA  720
AAAAVVDNAN LPMVPVAYGD ANHSRTDMLP RPSLASSAAQ LQTHGWPANG QQQAQHPQGS  780
NASQQQQQQQ QQQQQQQLLL SASPHASTLT DAPTPNGGVG GASSGVCYAM PVSAAAAAGA  840
SGAASACGSG PAMLVDGPGT GGTVPATGGT GAGTANTGLS SGDGAWGRAL EELNAMYGMD  900
PGGGAAALAG VGQGGTIFDT DYESDYDMVR LSYKLADCDP YSLDPSTPLL LHQVAAQGCG  960
SLAGPMPTSV RPGCVRVVAH ASVRRSIAAD ADSQPARDTG RGDGLNGGGG GGFNARAPGV  1020
LAAVQQLATL NETGVVLQAG SQTICVNKEG VEVAAPAASV PAAQLGSLVR ASVAAVQMGA  1080
RGSIQLFGSG LAAPNVELWG RMHGVHYQLQ VQHASDTYAL VALPLLPACG LLTIEAEWAA  1140
AAEPASPAGA AAWAAPAAGA PAALGAAAAG VGGAAAAVLS DWLAVAVVPS ERVAAELNAL  1200
QGRLPPASLR RLLCDVGSLL DVRPLLAQPV NGLCPVVGAA VVPPSSGCSK NTWRSSSLDQ  1260
DAVCGGGGGN PDGPGGGGDG PGANDDAATV ASVLEGFTST YSYTASTLAS NDGPSSKTTL  1320
GGATIATTGP GTHTRGSSTL GASGLGTSAS VTHASSVNAS VSASTAAGRA SAAVDLSVFM  1380
GAGTARGRST MALQNVHRLL GCFDTSELLT NADDETVVER LLGPGPATAL LSRAVSTLTF  1440
FANRCMVDSA LCVVAALSEL HRAFPDLLRA DLAPPPPPPP PAGGPQQRQA PGLMHAAVRC  1500
RSLALLLALA RCGDVLGEHV SMGRPGPGGV TPLHLAALLG RPHAIAGLHL AVPGVRELWH  1560
TAADDTGATP ADLLARSAAA AAAVAGATAG GAAAAAGGVV GAVAGAHVQG SAQQLLPLRP  1620
AGGRVSAAGG QSGGRALAGF SAAGAPPGAA APPPIRVLNA AHVGAGAVTG TVVLSPDQLL  1680
GEELPSDLSP VSTPTRDGSP PTRDGSFLRG PAGSSHPATA LFAPLPAPAP LIQTATSSQV  1740
QSAVAEALVH LPAPWVSGGD GVACDGCAGG DAGGGVPAAV VEREGAAPVE PETPVQVQEA  1800
AGQEQERKLG ELEVLDVAAG VPIGAVNIGA EQQRLSETES HSAAAAGGLS KAEPEEDEEA  1860
VASEARAGPL PTKAAPAAEA AAAAASSGTT GAASERPAIE PAVALAVFAL LVALLLRQLA  1920
SAWSWFRVGA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A8e-1841128188squamosa promoter binding protein-like 7
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre04.g212700.t1.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3DTY30.0A0A2K3DTY3_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP1158922
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-18SBP family protein