PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g112750.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1897aa    MW: 190770 Da    PI: 6.2694
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g112750.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP83.13.8e-2693169177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +C vegC + l+ +k+y+ r ++Ce+h  +p+++v+g+  rfCqqC+rf  l+ef  +k+sC  rL+k n+r r+k+
  Cre02.g112750.t1.2  93 TCVVEGCGVSLNGLKRYFTRLRICEAHLACPQIVVDGVLSRFCQQCGRFQPLDEFTGKKKSCTARLEKVNARHREKA 169
                         5***********************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-2589154IPR004333Transcription factor, SBP-box
PROSITE profilePS5114122.03491168IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.88E-2492169IPR004333Transcription factor, SBP-box
PfamPF031101.2E-2694167IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1897 aa     Download sequence    Send to blast
MSSATAARRR RPVAEQAQEE EDWTIDDWSW DARAMTARKK ARTDETANIS GVLAASTTII  60
VARVGPTVAN PKFSNLPIYN TLKKLDDAPS NPTCVVEGCG VSLNGLKRYF TRLRICEAHL  120
ACPQIVVDGV LSRFCQQCGR FQPLDEFTGK KKSCTARLEK VNARHREKAA AKQGTRRPDP  180
TPGPAPPQWE DGVPPEAVVV PQELLPSNLA VVGGGPVAGG SSGAAGVRGG VLGAATMPMA  240
GNVKPEPASS SGQAAGARGS SPAISGPTGG AGVADIARAS SLGHGATSSV DGVGAVGGMA  300
GMGSLQGAAS LQPAAPAAVS AGGAAGGSTS SGAVPLNKSG SFGAAASSGA GSSGAVAAAG  360
EEASVAAPGP ASGNEGGGVV SVLKLQRMVT TTGPGIVYYS TRRPTPPAPP KPALDPAASS  420
APASATSVPN RSPSTDSERA PSPGAEPRVE YWSLVTTAIA IRRSSGAPGT ASGGSLSLPV  480
PPPPEDVKRA LAVARPQLFQ PVAVVPASLQ AEGGGSGGGS PPGSVAGSGS QCNLVGMQGE  540
SRHSVGAESS GGVGSGSSGM PPRAQAPTAY VEAAARPSGS THSAASGGGV GPSGTAAAPP  600
SPHASQSTDG AATSAAGRGH ASGVVGPDGD VTGTFATSRP SSLPSSITHV AERLNTIMSE  660
LQPLMQQVQQ MAAVEGSTGA AGPLAVPGVA EGVVDAMNRA QSLAAMLQQQ QQRQASVEPA  720
PLQQAPSHMQ VQQQAPPRGQ PVAVQYTQSQ SLRSVLIRRP AVPPSQSAQP APAYVAHPAP  780
QQQMQANAQL PPQYSGQGYA APSVQLPPAS SGNFPPHSAA QQAYAMPSAP QQQSRLQQAY  840
GNGNGHVSMH AAISHAAAAG APMYDADSDD EDMLAELFQA MADDPDIVVG NGFAQGNSYA  900
NGNGHDATGQ PQPMQVQMQH QPQPMQAYFH RQQQQMPSAQ QQQQQVLYSQ QGPAPAGYSA  960
AQQQQQTQYV AAQPPPQQQH YHMDSHQQQQ VQQHPQMQVQ QHMHMQHQQQ QQHLQQQQQR  1020
QMQYAALLDQ QQQQMAAAAE AHARSRTVAV AAQQGIAVHR TALASMPYGV GGAAAAGVWP  1080
GMAPASAASM GVVDMPVEMD RVSIKAMNMQ PNELPGNLRQ GMARWLRGAN AEAVTATLRP  1140
GCLQLVVDVH RPLAAARGGA DLASLLIPGH DADQAAADVF RFMGQRLRDT YVQVGSQVLQ  1200
ILVGEDPAVV SWEQAAEIGG LEGAKQPRLA ACSAAAVCAG GAARLALLGT HLSQAGVNVF  1260
ARLRGRDLPA ATCEVEVEEE GAAGAPPSTP QSRDRLGMQV EVPAAGVGLM VVEVGVGHLL  1320
GGWWPVLVLP RGREAAAAEL TGLLGPGAAS AAVASTAAPA GAQEEGEESG ERRAGREMLN  1380
RRMILDLGQV LDTWAAITAA QTAAAAAAAA AEVAAVAAAA AAAEAEAEAL NSPLSPGGES  1440
SAGSASSNVS DGGAPGALAG PQRSASPDSP AMASAAAAAA AGGLARTSRS SVATATTTVS  1500
AAGGWGFTDA GDSFMLSSAM SSTRLTASRV SNAPGAANLA PIGERGRTGS GSASPPPEHA  1560
GGAALVPSGG RAGGAALSPA AAAGMAAAGR AAALSAAAAA AVASGPSVAM VRQSLCKTSR  1620
LLLFSVVRGL PRLTELLLDA AASLAAAAAA TTPHVAPAAV GASDPALLRE TLVAAGVDPQ  1680
VLLPLAVLAG STTTVDVLTC FAQEVLRAPL RLDLPQGPAG MSLLHLAALM DDGGAMSRHL  1740
IATQPWAPWA WICLSWCPPG LAENSSTPAA AAADAAAASA DAEEGDAEAE AGASSGSSSS  1800
ALRLTPGALS LLLGQEEPLR LAASLLSLRD GDVVAGGPER EAEMEHERRQ WQRQTLATVP  1860
EDEVLGGAVG EVMEAWGRMS AAVLQALCDH LAAARV*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g112750.t1.2
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E3380.0A0A2K3E338_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-18squamosa promoter binding protein-like 10