PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g110150.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1436aa    MW: 151894 Da    PI: 7.1786
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g110150.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP53.94.8e-17569644176
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         +Cqv++C++ ++  +e ++r ++Ce+h +a +v ++g++qrfCq C+r h ++ef+ + ++Cr r     ++r++ 
  Cre02.g110150.t1.2 569 MCQVDKCNQAMACQQEQYQRLRICEHHYHALEVQHEGMRQRFCQSCGRLHPVEEFESNMHACRARCGVDSRQRKRL 644
                         6****************************************************************98888877775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546952.43E-1813118IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.102.4E-2116124No hitNo description
PfamPF006511.8E-1524124IPR000210BTB/POZ domain
PROSITE profilePS5009713.2813296IPR000210BTB/POZ domain
SMARTSM002253.1E-1132126IPR000210BTB/POZ domain
SMARTSM008751.2E-10131230IPR011705BTB/Kelch-associated
PfamPF077079.4E-13132228IPR011705BTB/Kelch-associated
Gene3DG3DSA:4.10.1100.103.2E-18563631IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.392567644IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.7E-17568624IPR004333Transcription factor, SBP-box
PfamPF031102.0E-19570643IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1436 aa     Download sequence    Send to blast
MEEATEPGLC YRDKSKVVHE GLARFFNRET FSDLTVVDPD GNRIRCHQLV LSSCSRKFAD  60
MLEQGKVEEL PVRGVDAQGL YLVLRFFYTG ECHVDHTSVI AVYDAANRLD VDGLATACDV  120
YSKQLLGPGT ACTLFQQAQR FALQEFAESC SRIIRVRFDE VVHSEDFLTV DRPTLMKILE  180
DNIPHHNEGS IFRAAWRWGM SSLARMQEMP KVFKMVKVPN LSMQDLVNIA GPLPGPAPQL  240
VRNRGASNPT ATGHTAAGSQ FQQASARAPD TLEVLSPAKL REAQSYLIQQ MLGGMDLVRA  300
VRSTVQMYGS GDGEPPAPPA APAPCLQLGS HTLPPHRISG GVPGHCNGGG MPSAHYHQNQ  360
CFPAPQHQPA RYHRVTNNLD SMPSHPATAP AMPGTAAAAW NHLHHNQHHQ HESPEMANSC  420
AASGGHDVED DVQHQPRVPA GYQQASRGAH GGAGAAGRRG DGQQGTVFGG TGGERPSGTA  480
VSGTAGSGGD QDDAVSGARH AAAGGHGRGK DRDGDQSGVQ HQVMEALRKL NPDLQGQAIV  540
VVVNPTGSPP PAAAPPAAIV RHGSGVRVMC QVDKCNQAMA CQQEQYQRLR ICEHHYHALE  600
VQHEGMRQRF CQSCGRLHPV EEFESNMHAC RARCGVDSRQ RKRLRPDEHA DTAECRPAPG  660
MHGRVAMPQQ MPRHGAHQVA HHVAHQVAHQ VAHQVVQGVM LPASQPPQVP TWDWAMQSDQ  720
QRMHAGVPAV EHGQCQDLAA GTPSSTGSAG NAPQKHSGQM ALPPLPQPHL PQQGQRGGML  780
PPQQFHQQQQ QPNLASYPSV PPPRRPQMQP TDQPLHRVSS VPAQFQGGES NQHCMQPPAP  840
QQPQNAPVRH LSLSGLPTGA PGSMPLHPNQ RVRPSNPTPQ LQMQQAPDLP RQYSAPPQQG  900
QVVVQLQPAT GAQGEDKLVA FGAPAAGGMA KLILSTVPLD APAGNAGAGG AQGLMHAPSS  960
RPAGPQQPGQ LQAPLRRPSP GVVRPGGTDS HVSTSRGALP QQGGAPALRQ SLASGPGRPM  1020
APHHGMQSVN PGGRPGAPQR TTMPPPSSAP AQRQSAPRLA EGRAPSLNLR PSAEATGARV  1080
NAVPSQQLMQ QLPPPPQQAP TQASAQAGAP MWPAPQQGLP QAAQQHAFIQ QQQVQQAQQV  1140
QVPQAQRPLE QQQQQQQLPE QQAQPPQEGS LNQDAFCGQA ALASEYPQLQ SMPMHMDSTE  1200
YAYGEQACNG GAPQTADPSP PQPPQPPPPP PPGWQQLPPD QNALYGQGEL QYHQPQMQPL  1260
FHDGAMQAAG SAAAGNSAVG GAAGEEPTTP RHAGIRAPQV AVMGGGGMAA ALAATISGNA  1320
AVSSFDNRLG LPRDLRVSIN GNYSFGDLHE LVTPGSHGLL DSGLVSPNTE LFNILNTGNG  1380
AEDTLGMGPM LDLLGPGESM YDDTANTSQA LLPGPSGAGT AGPSVPPTLP LPPQQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.23170.0normal conditions| nutrient deficiency
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g110150.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001699939.10.0squamosa promoter binding protein
TrEMBLA0A2K3E2Y50.0A0A2K3E2Y5_CHLRE; Uncharacterized protein
STRINGEDP076350.0(Chlamydomonas reinhardtii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-12squamosa promoter binding protein-like 14