PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g104700.t1.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1382aa    MW: 143022 Da    PI: 6.4174
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g104700.t1.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP108.93.4e-3490166177
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         +CqvegC +dl+  k y++r+++Ce h k  +v v+g+  rfCqqC+rfhelsefD +krsCr rL  hn+rrrk+ 
  Cre02.g104700.t1.2  90 VCQVEGCGHDLTGEKGYYQRYRICEPHVKLLTVEVEGRACRFCQQCGRFHELSEFDGTKRSCRARLLLHNARRRKRD 166
                         6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.1E-3087152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.07788165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.05E-3089167IPR004333Transcription factor, SBP-box
PfamPF031102.3E-3091164IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048653Biological Processanther development
GO:2000025Biological Processregulation of leaf formation
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1382 aa     Download sequence    Send to blast
MEAVEHFSAA FSAQHQGWAS SKYAWDPSSL VAVPGPDAAR SSPSVEGDHG TDADRDQSLG  60
PTPINWKPAG ARNTGAESKS HAARLPKTLV CQVEGCGHDL TGEKGYYQRY RICEPHVKLL  120
TVEVEGRACR FCQQCGRFHE LSEFDGTKRS CRARLLLHNA RRRKRDPVDA STKEPRSQRK  180
AKATHPRSDD SNDNELDSRG SFGASHGTWP ASGAPTSVPV TEADPAATPA VSSGAVPQLM  240
TRAGLNDQSL PLPGFQQPVS QALQSAGYAP AFANTLAVKH EQPELLVSTS GGAAVLGVMM  300
QRESLPLDLA HAFSDEADLP LVDTLKLDDF MLDGLMAMDY IDELPGPRQL MPGGAGAAGL  360
AVAGPAGAAA ALGAGLSGNG HMGGLMPMEE QQERAVLLQQ QQQQQLRLAV AGPVAGYSPM  420
LTGDESMMGV GIMPPTAAMG SAALHAPYMP VSGDVSMSRA VPRTVLNEQS QMQQIADAQR  480
RLLQSAGVLP GPTHQGTFLA EPQQVNDGLN SGMSVCSLGG GGFTSPCSSG MGKPLGSGFS  540
VPPHPSAGSH HMMLSSGVTL NVPSAVPSPI NVGPSMAQAQ AQMQAQAPFG AVGGGMSSFD  600
MARRLVAGGG AGAQYRSDDF LVRVSIKVAN CTPEELPPDL YQRLQSLLAT ADASLIQGFL  660
RPGCVHLVLD ISGGEGLQQA LLAARVRSAL GPVAQKYATL VQVGEEVAMW AEDAPAAAQP  720
ASAARVPELE ATGAVPVLLH VSPAAYLCHS TADGSSSASV VVYGSGLVKA GVQLFARMQG  780
GYLPVRVQPL VAEGQLMVQG AEAVAALQDL AQLAQGGRSA TDALLVSVEG APASGLLLLE  840
AQAGPLLSAW RPCLLSVDSA MATELTAAGV QARAAGNDRL QSLESFVTDL GRLVDACSFA  900
KAGTGDAEEE AVSMERLCAC EHMLAWASEA GLPAVSSFLV HTLLQYGQEL GTVLEAPYAD  960
GLSVLHRAVR SRSEAMIRAV LGWAAREGVE LSWRGEDAVG QLSPLHLVAL VPVAWRVLAT  1020
EPAVQRAWAR ERAADGATPA LVQQILFSCL QAATNARRAS APVAEVVVAA GAQAAAAQVC  1080
AAPRTLETIE TAVAPSAAGA VSPATAPTPT RPASILRAVL PLMAVLAALT YASLMHTLQA  1140
SYLPVVVVTC VLMYALWRLL TTVAARPQHA VLMSMLASPL PPVFSSARLE AAYQMRASMA  1200
ATQLSRDAAA LLVLLAMCAA AARLPDASAF ATAVNTCLTL LPLAAMKLSR QGYIRVRDIA  1260
LTGAYVAMLN AICSTSQSLL ADSPRCRCAM LFLAVTTAAG AVAPLNTSGM LFTLAYTVSM  1320
AMRAWTQTQG LFGGASSVTA AQACSAAQLA VVAAATAVSF ARELAARQQW LAVAGEAASG  1380
K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-21901641084squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Cre.86010.0normal conditions| nutrient deficiency
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00307DAPTransfer from AT2G42200Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g104700.t1.2
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001699986.10.0squamosa promoter binding protein
TrEMBLA0A2K3E2I20.0A0A2K3E2I2_CHLRE; Uncharacterized protein
STRINGEDP076820.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42200.12e-19squamosa promoter binding protein-like 9