PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g085150.t2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1529aa    MW: 152971 Da    PI: 5.5268
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g085150.t2.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP41.14.7e-132482975
                        T-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                 SBP 29 kapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75
                        k+ +  ++g++ rfCqqC++fh ++efD + r Cr+ L     +rr 
  Cre02.g085150.t2.1  2 KSMSLSIEGRSCRFCQQCGKFHLVEEFDGANRNCRKALMIRFYKRRN 48
                        566778999****************************9877666664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.8E-13136IPR004333Transcription factor, SBP-box
PROSITE profilePS5114114.024149IPR004333Transcription factor, SBP-box
PfamPF031101.4E-11247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.19E-11550IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.60.104.2E-4696753No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1529 aa     Download sequence    Send to blast
MKSMSLSIEG RSCRFCQQCG KFHLVEEFDG ANRNCRKALM IRFYKRRNMP LGGMQASLER  60
NDPAAGMGDP VEVRVEPRKR GRPRAPRPNI TEDDPGAAAL AAGGGLPPPG LVGSNAAARA  120
AAAAGFDSGL QAAYIAASRG YQGSSGVGVT PATAIGPPGY SQGGVRMAGI QVQSGNYDNN  180
NNNDGDDDSD AAPPRQRRSK GASAARRASP GSSGAAGSGG LDLNGGQQLD GLNALGGGLP  240
PLGDGLSGAG LGAGSFDVLG GGGPLEGLPG LPGRTHGGGL GWRSGALGSA GHQVGGLGLV  300
DGGLGLGGGG GLRLGDLGLP LPLPGIGGGR GGGAGLGALS GLGLRGGGLL DAAGHGVGGA  360
GAGGLLLDAL GGAGRLLAQA GQPMRLVLQP QLDGSRRGGG SGNQSVGCSS SHSQHEQLQD  420
DSSGLVGPLS RAAGATRGVG LVGQQQQQGA TSRDAAAEAL AALAASGQLD VQMLLAAVAA  480
SGGTASEQQA VLVALLAKLP GGAELLGSAG LQPRQEQDLE AGNPERPLPA GLQRLAGRDG  540
LGGGRAGLLP LALAQDHEGV GNLGMGRLSN GTGGGGGRPL PALDVSGAVR PLGGGLGGLG  600
RGRSVGLDMG AVGAAAAAGG GSGGSGRPAV TPLGTGLLGT ARGRNANPDM DFPLRLDDGL  660
PATLVGIGRL AAPGAGDGAG PLAEDDVCAG GGGMGELSLA DLLGQMSIPQ QLELLMGLPQ  720
QQMTEVLKQL PHTQQVELLL ALQEDRQNRV MAERQQQQQQ QQQPQQQQQQ QQQRQQQRQI  780
GAGGPQPQVL MLGAQGLRAA EIGGSGGGLG PRALKLDPED VPGRVGLLES LAAGARLNLA  840
PLGRAAGARG GALEGTEDEK AGLTRLQHQV SGKGFGAAHA AAQSLAAGTA YAAAGEASNM  900
QTTPGRLQPP PDGADRRGNS GEAVKLEVPE RAAKAFNSAK ASSSPGNTAS GATEQQQRQP  960
AVKQQEEEQP QSEGNNAAGE ASGRGGDRDG GNTGGAALDG CGDAAAAANT AEVAAAGDAA  1020
DVADAAHDAA YSCEEALERL SLKLHGVRPD ELAPDVAQRM HKWLESMDAV TLQGTLRSGC  1080
VNLVFDVSYR QPPAATDAAT RSTLTTSDAA GHRRAWAYRL AAAAIASSLG LELPAPFAAG  1140
GGRQRGDEAT EGGQWCGLCL QAAALAAARG IRVQVQVGNA VVYPPHAKQT PLAEQQQPAT  1200
AEVHELAPLA IVQGDHHAVA IMSGRGLNDP SARLHVRLNG RRLGALVQPQ QEQQLPPTDA  1260
DSKTGAVCSA AAGNYPMQGP SAQEQEQQRC GEECALVFLD APGQAGLAVL EWEAGGGAGV  1320
LGDWWPLVVA PDAQVAAEVN ALALNSDIAS GRGTEWLRRL LVDVGLVIDA AHNSPAGGLH  1380
AGLEPGVLER LVCRARCVVP FCEARMMPHT AAVARAFLAA AAAETETEAD AGIAAVSKLP  1440
SRASWSLSSS ACGSDFDYSD SEQKQEDHMD SSAGDATSPG TGQCSRSGVC KCPDSPCAGC  1500
FCYNTDGVKL ECCPPRPGIA ETGSAHAR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g085150.t2.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001701724.10.0predicted protein
TrEMBLA0A2K3E0W20.0A0A2K3E0W2_CHLRE; Uncharacterized protein
STRINGEDP066990.0(Chlamydomonas reinhardtii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.13e-07squamosa promoter binding protein-like 8