PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre02.g085150.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1645aa    MW: 165822 Da    PI: 6.7117
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre02.g085150.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP77.42.2e-2492164375
                         SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S CS
                 SBP   3 qvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrk 75 
                         + +gC+adl++ k y+rr+++Ce+h k+ +  ++g++ rfCqqC++fh ++efD + r Cr+ L     +rr 
  Cre02.g085150.t1.1  92 RLQGCHADLTTSKAYYRRFRICEAHMKSMSLSIEGRSCRFCQQCGKFHLVEEFDGANRNCRKALMIRFYKRRN 164
                         5789***********************************************************9877666664 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.8E-2787152IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.16288165IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.89E-2292166IPR004333Transcription factor, SBP-box
PfamPF031101.0E-2293163IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.60.104.5E-4812869No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1645 aa     Download sequence    Send to blast
MARLEAREGV VPSAGGRADA RPEVACLVKV SVARARAGPA GASGFRKEGI RTLFERLMGR  60
TGYRRRTFGH VDRGHTHHAL APRTAHHVRV VRLQGCHADL TTSKAYYRRF RICEAHMKSM  120
SLSIEGRSCR FCQQCGKFHL VEEFDGANRN CRKALMIRFY KRRNMPLGGM QASLERNDPA  180
AGMGDPVEVR VEPRKRGRPR APRPNITEDD PGAAALAAGG GLPPPGLVGS NAAARAAAAA  240
GFDSGLQAAY IAASRGYQGS SGVGVTPATA IGPPGYSQGG VRMAGIQVQS GNYDNNNNND  300
GDDDSDAAPP RQRRSKGASA ARRASPGSSG AAGSGGLDLN GGQQLDGLNA LGGGLPPLGD  360
GLSGAGLGAG SFDVLGGGGP LEGLPGLPGR THGGGLGWRS GALGSAGHQV GGLGLVDGGL  420
GLGGGGGLRL GDLGLPLPLP GIGGGRGGGA GLGALSGLGL RGGGLLDAAG HGVGGAGAGG  480
LLLDALGGAG RLLAQAGQPM RLVLQPQLDG SRRGGGSGNQ SVGCSSSHSQ HEQLQDDSSG  540
LVGPLSRAAG ATRGVGLVGQ QQQQGATSRD AAAEALAALA ASGQLDVQML LAAVAASGGT  600
ASEQQAVLVA LLAKLPGGAE LLGSAGLQPR QEQDLEAGNP ERPLPAGLQR LAGRDGLGGG  660
RAGLLPLALA QDHEGVGNLG MGRLSNGTGG GGGRPLPALD VSGAVRPLGG GLGGLGRGRS  720
VGLDMGAVGA AAAAGGGSGG SGRPAVTPLG TGLLGTARGR NANPDMDFPL RLDDGLPATL  780
VGIGRLAAPG AGDGAGPLAE DDVCAGGGGM GELSLADLLG QMSIPQQLEL LMGLPQQQMT  840
EVLKQLPHTQ QVELLLALQE DRQNRVMAER QQQQQQQQQP QQQQQQQQQR QQQRQIGAGG  900
PQPQVLMLGA QGLRAAEIGG SGGGLGPRAL KLDPEDVPGR VGLLESLAAG ARLNLAPLGR  960
AAGARGGALE GTEDEKAGLT RLQHQVSGKG FGAAHAAAQS LAAGTAYAAA GEASNMQTTP  1020
GRLQPPPDGA DRRGNSGEAV KLEVPERAAK AFNSAKASSS PGNTASGATE QQQRQPAVKQ  1080
QEEEQPQSEG NNAAGEASGR GGDRDGGNTG GAALDGCGDA AAAANTAEVA AAGDAADVAD  1140
AAHDAAYSCE EALERLSLKL HGVRPDELAP DVAQRMHKWL ESMDAVTLQG TLRSGCVNLV  1200
FDVSYRQPPA ATDAATRSTL TTSDAAGHRR AWAYRLAAAA IASSLGLELP APFAAGGGRQ  1260
RGDEATEGGQ WCGLCLQAAA LAAARGIRVQ VQVGNAVVYP PHAKQTPLAE QQQPATAEVH  1320
ELAPLAIVQG DHHAVAIMSG RGLNDPSARL HVRLNGRRLG ALVQPQQEQQ LPPTDADSKT  1380
GAVCSAAAGN YPMQGPSAQE QEQQRCGEEC ALVFLDAPGQ AGLAVLEWEA GGGAGVLGDW  1440
WPLVVAPDAQ VAAEVNALAL NSDIASGRGT EWLRRLLVDV GLVIDAAHNS PAGGLHAGLE  1500
PGVLERLVCR ARCVVPFCEA RMMPHTAAVA RAFLAAAAAE TETEADAGIA AVSKLPSRAS  1560
WSLSSSACGS DFDYSDSEQK QEDHMDSSAG DATSPGTGQC SRSGVCKCPD SPCAGCFCYN  1620
TDGVKLECCP PRPGIAETGS AHAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-1588163883squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre02.g085150.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001701724.10.0predicted protein
TrEMBLA0A2K3E0U50.0A0A2K3E0U5_CHLRE; Uncharacterized protein
STRINGEDP066990.0(Chlamydomonas reinhardtii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-16squamosa promoter binding protein-like 8