PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g043550.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1158aa    MW: 115048 Da    PI: 8.4244
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g043550.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP70.82.6e-222631273
                        TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                 SBP 12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73
                        ++ ++y++rh +Ce h k+ + +v+g++ rfCqqC+r h l+efD ++rsCr rL++ n rr
  Cre01.g043550.t1.1  2 ASERKYYQRHMICELHLKCLTLVVEGQRMRFCQQCARLHPLTEFDSDQRSCRVRLKHRNTRR 63
                        6779*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114120.179166IPR004333Transcription factor, SBP-box
PfamPF031102.7E-21263IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.107.4E-20353IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.02E-19364IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1158 aa     Download sequence    Send to blast
MASERKYYQR HMICELHLKC LTLVVEGQRM RFCQQCARLH PLTEFDSDQR SCRVRLKHRN  60
TRRVLLKRQR REEERRRGEG EQTGAAAGTA PAAGNASGSA LKRTAQQGAQ LRAAAGGAAA  120
DDDRTISEDE VGDIGSESPT SSSGGDGGGR RATRRPAAAA AAATAAAADG AVGGGGRVTR  180
AATVAAAAAA AAAGAAAGCG GMNGGCTISD LLGAAAAAVH NDEGRQLQQA AQMTAAGDDG  240
GAAADGGRVA EQQQQMRGRA PPPHSSASDL AAAVQRAKVA IDVAADTHQQ MAVATAAQQQ  300
QQALADAPHN AGGAAVGRRS NYGSDTPPAA RPYGNACSGG GASRFAHYSS GSFGGAAAGA  360
DGATALTASG GGAAGAAAAA GGGGPMASSS LAVKAHSAGG GEQQALLGFY NSPPQQRQEQ  420
QYGMEGGMNG AAAAWGSSPG SPMTLLMNYV SAGLDGRGGG SCNAELGARQ LQRPHQQLSA  480
VAGLAAAAGP ANGGGSGGAG GGGQYMMLNG GSPSQQQLLL VEDLQQQQER RPTDAPPSSL  540
LGPRFPSSAS AAAAAAALGY SASFGAPRSP MYMSPPLAGA GGGAPFGGGY GGGPLGGSPG  600
LMTGSVDSHG DRHQQLMQQL QQPRMRQQQV YGSDAALLPA DGGGGGGGYG GGRSLMPPQQ  660
QQQQQALQLD ALGLLAAAGR GRQAGSQLSL LGLNSNGGSG GSGGGHRQSD AAAAGGGVML  720
DLHFQQQRQQ QLLERSPLQL GLPGGSFISD AGGALDDSSS MQLQQQPQLQ QQPYDHNLLV  780
LQQHQQMQMQ LWSAGGAAPA APIFVSGGSG CGPSALAAAH HGGGGGGGAA LLLGSSQHDL  840
AAGILGAAQG SSSADGTGGA GWARGGANGG GGLFSGLDNA ARGGSWSNMT TAAPPPMFGH  900
LSQQQASGVA GGLMYGGGGS GGSGDGGGSM TGMAALDPRM LSRQHQQQAS GHRTSTTTGS  960
WLLGNSAPPA GAGVSLLGGG TGGAHGGGTG GSGGGGKQLS PLPLPPRAHS LSRAGSSPAT  1020
GSGTLDGSLL PAGALVTSLG GGSSGWILGQ QQASAGAAGG LAGPAKVIAA LQLPTAAAAL  1080
NWQQQQQHHP SRTEHQQYQQ QRLHQRFEQQ QQQLLQMSNE VELHTQQQQQ RNQFVMQQHM  1140
QQVQDLQEQQ QYHHHYQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-131632082squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15870RNTRRVLLKRQRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g043550.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E7K20.0A0A2K3E7K2_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.42e-17squamosa promoter binding protein-like 10