PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g033900.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1122aa    MW: 108104 Da    PI: 7.246
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g033900.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP80.32.9e-2550122173
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT------ CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerr 73 
                         +Cqv gC+adl+++k+y++r+++Ce h kap+  ++g+  rfC qCs+fh++  fD ++r+C ++L+k  + r
  Cre01.g033900.t1.1  50 RCQVGGCTADLTDVKKYFQRYRICERHLKAPSLKMDGRAVRFCDQCSKFHDIGAFDGARRTCTEKLEKTRQAR 122
                         6*****************************************************************9876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-2644111IPR004333Transcription factor, SBP-box
PROSITE profilePS5114121.8848125IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.68E-2449122IPR004333Transcription factor, SBP-box
PfamPF031109.4E-2651122IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1122 aa     Download sequence    Send to blast
MDEDYDTANM HNYAAGSNVA RWGRLEELDP GDEAFLKSLE RKQQLRKPLR CQVGGCTADL  60
TDVKKYFQRY RICERHLKAP SLKMDGRAVR FCDQCSKFHD IGAFDGARRT CTEKLEKTRQ  120
ARVVRRMRRG GGGGGGGGAG GGGGGGGDGE GSGRRGRRQQ RGEGGSDGGG GGEGSSSDGG  180
DGDGDGDGDG DGGGSGSGRY GGASGSGSEH AVKRRRWEAA EDEDRGGGDD YDMPADGMHG  240
SGGLSGGGLG GGLGGGGLGG GLGGGLGGGL GGGGGSVYGS DRAAAATAAA DRELLPGGAD  300
NRSLRDFDGL AAAGAAGTAP PEPLDLRLPP MGLAGGGLLQ PPLLPPADLL GRGGGGGSGS  360
GGLEPMGGLL QALNGGGGGG SMSLDLEQAP LLGMHASSPA SLGGGGGGGG GGAGGGDLGR  420
SLLLSRTSLL LPGGGAGAGA GGINGGGGGH GRLLGGDDGV MGAVEAGLQR PLSATRLLLR  480
GLSGVPLGRS GGSSNLSAEA VAAAAAGLAA AVAGTGGGGG GGAGGRGRGS GGGGGGVRSG  540
GGATNVVPGG GKPDDVHMAG SDDDDVVIVS DAAAIAAARQ ARATRPGSGG SNAAAAAAAA  600
SAGAAAGGNG GDALDGAAAG ARASQTHRLA DLPQPGGGAA GGGGGAAGGG GAPQVPSPAP  660
PLTSPVAAAA ASAAQRPPPP AQPSPGLGEA LQLQLQQLQL PGRATAHLLG LVQALDEAGA  720
APEDVAAVLA RVPLMLVRHR TAAAAAAVAT DGVNGNGNGA GKGNGNGAVD GGLSGGGGGG  780
SGAGAGDVVV KVERDVEEGG GGGVGPELLL RLRHQQQQQQ QQQQRQQQLR DELLGRNDGG  840
RASEYSPRRP AAVAALTGGG FGGGGGGGAA APDDVYTACS QQLMARQLGV RINGYPSRPS  900
PPPSPPPLAQ QQQQQKQQQV QQHKQQQQQQ LQQQLQQLQQ LQKLQQLHNH QQQQPQQQQR  960
PLQPPARQLS GASNLHQELR AQMERLAPAG GASGAGERGG GGGGGGGGGQ MYRSLPALSG  1020
RQQLLQPDQA PGLLLQLGGG GGGGGGGGGG AAGPAAEFGR SRNEVVSLGD GCGGDGGGGG  1080
GGAGGGGGGG DGLEVQYRYL SVMQERLLRQ LGLPKQAWQQ Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-16511221182squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118128RQARVVRRMRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g033900.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E6Y60.0A0A2K3E6Y6_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP48281320
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.13e-18squamosa promoter binding protein-like 3