PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cre01.g012200.t1.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Chlamydomonadaceae; Chlamydomonas
Family SBP
Protein Properties Length: 1377aa    MW: 136892 Da    PI: 7.0754
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cre01.g012200.t1.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP113.99e-36920994276
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                         C+v++C++dls++keyh+r+++C++h ka+vvl +g+ qrfCqqC+rfh lsefD +krsCr rL++hn+rrrk+
  Cre01.g012200.t1.1 920 CHVDDCNVDLSSLKEYHQRFRICDFHLKAEVVLREGIPQRFCQQCGRFHLLSEFDGTKRSCRARLQRHNARRRKR 994
                         *************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF546951.57E-1725133IPR011333SKP1/BTB/POZ domain
Gene3DG3DSA:3.30.710.102.8E-1927134No hitNo description
PfamPF006511.7E-1733134IPR000210BTB/POZ domain
PROSITE profilePS5009713.5739105IPR000210BTB/POZ domain
SMARTSM002254.2E-1340135IPR000210BTB/POZ domain
Gene3DG3DSA:4.10.1100.102.4E-31913981IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.368917994IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.79E-32918996IPR004333Transcription factor, SBP-box
PfamPF031101.9E-30920993IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1377 aa     Download sequence    Send to blast
MALPPDPEAG GAQAFVYRDA SARGMYAGLA PHFNDRRLSD IVILRPDGRS IYAHQVVLAA  60
CSRKFSNVFG HGEATGKELP IQGVDSEALE LVLSSFYRGE CKLTPTTVVP IYDVCLKLEV  120
PGLTSACEQF LQRSMGPDTC CMYLEAALAV LLEHTVKMCL SYAKDRFEEI AAAPSFLRLS  180
TKSVRLLLTS TRNSGSGIND ISLARALARW AVSKPDHLSE CESIFKELNV TTTALLQLLQ  240
SADFVHALQG QQKPGTGQGS TAAAGGGGGG SGGAGGGGST TGRQPPPPLP RQQQQQAGLA  300
APSAAPQQQQ LQQQQIGAGH GREGDRGTFG YAPDANSRDA REGAAGGGGM GNGRLGGASG  360
SPAHVAGAHM QQGQAAGTGG PPPPHAGGHS AQQQLRNSPM LASGGSGSRA AERGGPTDYG  420
EGPPGGMRPP AAAAGTTAER GDRYDRTGWY SGGGSGAGRG LAGQAGPPGS GLTAGRPGGG  480
RSSPPPPFGR QSHLVEHAAG AGAGSERVGG IDGGPFQRRS LPSELLAGGP GIGGGGGDDD  540
RQAYARRYGG GSDRAAPDSE LAGAAATTRG GGGGGGGSGG GGGGERDNLV AVPLPVLEQL  600
GLTVRLTSSG ALAATGGPLG SKQVPLSVSG SGRSGPLMAM LPAGLVKYLQ QVGSGGPMPY  660
EAGGGSGRSG AGGAAAGRLD DGSPPLPPGL LPPQQHQQQP RAYGSADRAL DRNGGSGLSP  720
HAAGPSGRGG AGLGPHQRSS LDMLSTVAAS AEEEAGFVDI PGLPRLGQTG GGRLMAPRSA  780
SLGLGGLATE VGASGGRSGR FDLLGLGGLA PHLTADGGVA GRWSVPGAIA GTSGSLLPLG  840
GSLGGPGDLL GGGLNGGSRA PLGGMSKRQR PSPEDLDPDH EEPGLGLGGA GGGRGGGLTP  900
GGGARARGGG GYGSKGPLLC HVDDCNVDLS SLKEYHQRFR ICDFHLKAEV VLREGIPQRF  960
CQQCGRFHLL SEFDGTKRSC RARLQRHNAR RRKRPDQRGD SDDVPRRQRP VYQTMRQPPY  1020
LSAGVAAGNM ALAAAAAAAA GVGAPLSGGD AGGLHIPDLT SLPPAGSSGD GPHAQLPLDL  1080
QQLLAQQHTL PTGGVAGWPD GWPGGGGTAD DADGDGDYDA EDNGGPSGDD AAMEGTPEDG  1140
DNRFTPQQLQ QQQQAGAMRG GGSAAAGSGI RSQIIRDILM QAEERQQSEQ QQRQQAAGQG  1200
QGQQNAAPPA AASGARASLL DLAMAVRAQE GEARPPDAAG GTAGGGRTPK QGVDMDQQQS  1260
AGAARGAGLD GRSGAAGEAA DTDGVPPATA TAGGGGASNV GDGNSPRRPQ QPSTAAMPQP  1320
PPQAPSPPPA VKIKLEPTTS ADVADGARMP ADAAATATSA AGDDTRAAAA AAGGGK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-26910993184squamosa promoter binding protein-like 4
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00060PBMTransfer from AT3G60030Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapCre01.g012200.t1.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3E5K70.0A0A2K3E5K7_CHLRE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-20squamosa promoter binding protein-like 8