PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_96.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family ARF
Protein Properties Length: 689aa    MW: 76054.7 Da    PI: 6.8299
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_96.40genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.84.3e-23131231198
                                  EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT-- CS
                           B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLk 75 
                                  f+k+lt sd++++g +++ +k+a+e+       +   + +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L 
  evm.model.supercontig_96.40 131 FCKILTASDTSTHGGFSVLRKHATEClppldmtQ--ATPTQELAAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLV 210
                                  99****************************9543..445569**************************************** PP

                                  TT-EEEEEE-SSSEE..EEEEE- CS
                           B3  76 egDfvvFkldgrsefelvvkvfr 98 
                                  +gD +vF   + +++el+v+v+r
  evm.model.supercontig_96.40 211 AGDAFVFL--RGDNGELRVGVRR 231
                                  ********..3489999****98 PP

2Auxin_resp103.72.3e-34257336183
                   Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                                  a+ha++t++ F v+Y+Pr+  s+F++ ++k+++++k+ +svGmRfkm+fe+eds+err++Gt+vgv+d+++ +W++SkWrsL
  evm.model.supercontig_96.40 257 ASHAVTTNTLFIVYYKPRT--SQFIIGINKYLESVKHGFSVGMRFKMRFEGEDSPERRFTGTIVGVEDISS-QWSGSKWRSL 335
                                  689***************6..9**********************************************777.*********9 PP

                   Auxin_resp  83 k 83 
                                  k
  evm.model.supercontig_96.40 336 K 336
                                  6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.44E-40120260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.2E-40124246IPR015300DNA-binding pseudobarrel domain
CDDcd100178.99E-20129231No hitNo description
PfamPF023624.4E-21131231IPR003340B3 DNA binding domain
SMARTSM010191.6E-21131233IPR003340B3 DNA binding domain
PROSITE profilePS5086311.928131233IPR003340B3 DNA binding domain
PfamPF065073.5E-32257336IPR010525Auxin response factor
PfamPF023092.3E-11548656IPR033389AUX/IAA domain
SuperFamilySSF542773.78E-13570649No hitNo description
PROSITE profilePS5174525.21573665IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 689 aa     Download sequence    Send to blast
MAHVDGNLRG SASSRGVSGR ESDGDLYREL WKACAGPLVE VPRSGERVFY FPQGHMEQLE  60
ASTNQELNQQ IPRFNLPSKI LCTVVHIQLL AEQETDEVYA QITLQPEADP SEPPGPDPCL  120
PEPPKRTVHS FCKILTASDT STHGGFSVLR KHATECLPPL DMTQATPTQE LAAKDLHGYE  180
WRFKHIFRGQ PRRHLLTTGW STFVTSKRLV AGDAFVFLRG DNGELRVGVR RLARQQSPMP  240
SSVISSQSMH LGVLATASHA VTTNTLFIVY YKPRTSQFII GINKYLESVK HGFSVGMRFK  300
MRFEGEDSPE RRFTGTIVGV EDISSQWSGS KWRSLKIQWD EPATIQRPER VSPWEIEPFL  360
APSSVNLAQP AIKCKRPRPV DVSVSEITTN SAASSLWYNG PSQSHELNQL SSPADVQSCD  420
SQVVWSTRQK EIDGSLVNSS GGCNSRVRQE GIWSSTPVNV SLSLFADSAE DNKTVLSSRP  480
KSGVMHDQVE KGKKSEISAG CRLFGINLTE KSSASATHPA VDSSTAQGPV PVTDVADKDR  540
DLEASSSAKE QKQDTLEVSV KESQSKQGSS TMRSRTKVQM QGIAVGRAVD LTALKGYDEL  600
INELERMFEI KGEIGPGNKW AVVFTDDEGD MMLVGDDPWL EFCKMVKKMV IYSSEEVKKI  660
RRKFKFPMSS VESEGTVGSL DSEHKSET*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-17983591355Auxin response factor 1
4ldw_A1e-17983591355Auxin response factor 1
4ldw_B1e-17983591355Auxin response factor 1
4ldx_A1e-17983591355Auxin response factor 1
4ldx_B1e-17983591355Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1374378KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_96.40
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021893040.10.0auxin response factor 18 isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A067K0910.0A0A067K091_JATCU; Auxin response factor
STRINGevm.model.supercontig_96.400.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Representative plantOGRP5501582
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Wójcikowska B,Gaj MD
    Expression profiling of AUXIN RESPONSE FACTOR genes during somatic embryogenesis induction in Arabidopsis.
    Plant Cell Rep., 2017. 36(6): p. 843-858
    [PMID:28255787]