PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_919.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 144aa MW: 16469.8 Da PI: 9.902 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 99.2 | 2.6e-31 | 57 | 115 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 +dDg++WrKYG+K+vk+s++pr+YY+C+s+gC+vkk++er+++dp++v++tYeg+Hnhe evm.model.supercontig_919.2 57 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSRGCHVKKRIERERDDPRYVITTYEGTHNHE 115 69********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.1E-33 | 44 | 117 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 6.41E-28 | 49 | 117 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 32.019 | 52 | 117 | IPR003657 | WRKY domain |
SMART | SM00774 | 5.7E-34 | 57 | 116 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.6E-24 | 58 | 115 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
GO:0042742 | Biological Process | defense response to bacterium | ||||
GO:0050832 | Biological Process | defense response to fungus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MEVIEGASPP TSYNPTPTSS TNKINIRCKS YLEGVKKEKM EVGQRVAFRT KSEMEVMDDG 60 FKWRKYGKKS VKNSPNPRNY YKCSSRGCHV KKRIERERDD PRYVITTYEG THNHESPYVV 120 YCNKMPLMLP TLQIAPLHSS SSS* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 2e-26 | 47 | 117 | 7 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 2e-26 | 47 | 117 | 7 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_919.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021898788.1 | 1e-103 | probable WRKY transcription factor 50 | ||||
Swissprot | Q93WU9 | 6e-42 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A1U7YVI0 | 2e-55 | A0A1U7YVI0_NELNU; probable WRKY transcription factor 51 | ||||
STRING | evm.model.supercontig_919.2 | 1e-103 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM5711 | 27 | 47 | Representative plant | OGRP14 | 17 | 875 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-43 | WRKY DNA-binding protein 51 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_919.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|