PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_83.97
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HB-other
Protein Properties Length: 663aa    MW: 74810.6 Da    PI: 9.27
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_83.97genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-192076157
                                 TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                     Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                 r+kR+  t+ qle+Le+ ++ ++yps+++r+eL+++lgL++rq ++WF+ rR k++k
  evm.model.supercontig_83.97 20 RSKRQMKTALQLEILEKTYAAESYPSEATRAELSTQLGLSDRQLQMWFCHRRLKDRK 76
                                 789****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-19476IPR009057Homeodomain-like
SuperFamilySSF466895.99E-171477IPR009057Homeodomain-like
PROSITE profilePS5007116.8921777IPR001356Homeobox domain
SMARTSM003896.2E-171981IPR001356Homeobox domain
CDDcd000866.18E-142077No hitNo description
PfamPF000463.6E-172076IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 663 aa     Download sequence    Send to blast
MEAASEGEKK KPAPEGGEPR SKRQMKTALQ LEILEKTYAA ESYPSEATRA ELSTQLGLSD  60
RQLQMWFCHR RLKDRKTPQA KRQHKDSPSL GGLTANGNEI VAVEAANEHV PGSGLRSSPF  120
SHGGESRRLV LRPGVAVPRI AGVVKRYHEP PRLPSPPPLQ LAAELRAVAF VEAQLGEPLK  180
EDGPILGMEF DPLPPGAFGA PIATSLHHTQ SGQAFGAKIY DHPDTKLIKG SGRILREYQF  240
LPEQPSVRAD QYERVSSSHH YGSLIENSNA RSSVTSAGHL LLHGDEKIPS GYGFPTQASN  300
LNLLSQQGRQ GYLLSSGECD NVPQKNSFTN TPMDANFGTH PITALENPFV SSDRRVIHDE  360
DVSRMERKRK SEEARLAREI EAHEKRIKKE LQKQDILRRK REEQIRKEME KHDRERRKEE  420
EKLLRERQRE EERYLREQKR EKERKEKVLQ KESIRAEKMK QKEELRRARE AAKLKAANER  480
ALARRIAKES MELIDDERLE LMELAASSKG LPSIVSLDFE TLQNLDALRV TYEPEICINI  540
MRICTLTLEA KWNEETITKI PWDRVFYRAV TVRSCLSIGC GGREPIDDLI SNEPLNNNRK  600
GDGGQGYWIM AIRTEGAPWA NSGSYRSIQW GMGGDRPTGS GRRMFGWLTI GGADFSRDSL  660
ND*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. In association with CHR11 or CHR17 may prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing, such as FT, SEP1, SEP3, AGL8/FUL, SOC1 and FLC (PubMed:22694359). Involved in the transcriptional regulation of seed-specific gene expression (PubMed:23872538). {ECO:0000269|PubMed:22694359, ECO:0000269|PubMed:23872538}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_83.97
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894260.10.0LOW QUALITY PROTEIN: homeobox-DDT domain protein RLT2
SwissprotQ9FFH11e-147RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A2I4F9F30.0A0A2I4F9F3_JUGRE; homeobox-DDT domain protein RLT2-like isoform X3
STRINGevm.model.supercontig_83.970.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96012530
Representative plantOGRP15771634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.21e-114Homeodomain-like transcriptional regulator