PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_81.126
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 771aa    MW: 86176.7 Da    PI: 5.387
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_81.126genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS386.62.9e-1183977671373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL+ cA+avs++d + a++lL+++++++s+ gd  qRla+yf++ L+arla++++++y al+++++s   s+  l+a+
  evm.model.supercontig_81.126 397 LRTLLILCAQAVSANDSRTANELLKQIRQHSSSFGDGSQRLAHYFANSLEARLAGTGTQIYTALSSKRNS---SAVMLKAY 474
                                   5789*********************************************************999999988...9******* PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +++  ++P++k++ + aN++Il a+e+++++HiiDf+is+G+QWpaL++ L+ Rp+gpp+lRiTg++ p+sg   ++ ++e
  evm.model.supercontig_81.126 475 QTYISICPFMKIAIIFANHTILSAAEKATALHIIDFGISYGFQWPALIHRLSMRPGGPPKLRITGIELPQSGfrPAKGVQE 555
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+ L+k++e+++vpfe+++ + +++e++++++L+++p+E +aVn+ ++  +llde+v l+s+r++vL+l++++sP++++ 
  evm.model.supercontig_81.126 556 TGRHLEKYCERFNVPFEYTA-IGQKWETIKINDLKLNPDEFVAVNCLFRFRNLLDETVVLDSPRNAVLNLIRKISPNIFIQ 635
                                   ********************.7*********************************************************** PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + ++n++ F++rf eal +ysalfd+ ++++pre+e r + E+e+ grei++v+aceg+ r+er et+++W+ r ++a
  evm.model.supercontig_81.126 636 AIVNGSYNTPFFVTRFKEALFHYSALFDMCDTNMPREDEMRLMFEKEFYGREIMSVLACEGTGRVERPETYKQWQVRNSRA 716
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   GF+++pl+ +   + k+ ++    + ++v+e+sg++++gWk+r +++ SaW
  evm.model.supercontig_81.126 717 GFRQLPLDPELIRKFKCKVKDSFHNDFMVDEDSGWMLQGWKGRIVYASSAW 767
                                   ********************998788************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.725371748IPR005202Transcription factor GRAS
PfamPF035141.0E-115397767IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 771 aa     Download sequence    Send to blast
MDPQFNEYLN SMEGFTFENE SIFPNSDQSQ NLGNGFKLNN PTLDLQSIGL PPDPSFPNSD  60
SAWSRIIDGD SSSPSDDNDF SDTVLKYISQ VLMEEDMDEK PCMFHDALAL QAAEKSLYEV  120
IGEKYPPSPD QPPIYSNKTV DSPDDCCSSG FSDSSTNSHS SPSTSTSFDS HSSGNLVEHQ  180
LSWLQTPVPT NFVFQSTSNS GKKSSFNSAD NVFYHGNGLV RSSMSELLDK NLFNESDSML  240
QFQRGVEEAS KFLPKGNQLI IDLESYKPSA ESKDKAPNVV VKTEKHDTEL SPNQLIGKKS  300
HEREDEDLED GRSNKQSAVY GDESELSEMF DKVLLYGGGN EQPGACILDY SREQGALTTL  360
VQNESSKPLQ KNGLTNGSGG GKSRGKKLGK KKEVVDLRTL LILCAQAVSA NDSRTANELL  420
KQIRQHSSSF GDGSQRLAHY FANSLEARLA GTGTQIYTAL SSKRNSSAVM LKAYQTYISI  480
CPFMKIAIIF ANHTILSAAE KATALHIIDF GISYGFQWPA LIHRLSMRPG GPPKLRITGI  540
ELPQSGFRPA KGVQETGRHL EKYCERFNVP FEYTAIGQKW ETIKINDLKL NPDEFVAVNC  600
LFRFRNLLDE TVVLDSPRNA VLNLIRKISP NIFIQAIVNG SYNTPFFVTR FKEALFHYSA  660
LFDMCDTNMP REDEMRLMFE KEFYGREIMS VLACEGTGRV ERPETYKQWQ VRNSRAGFRQ  720
LPLDPELIRK FKCKVKDSFH NDFMVDEDSG WMLQGWKGRI VYASSAWVPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A2e-5240476926380Protein SCARECROW
5b3h_A2e-5240476925379Protein SCARECROW
5b3h_D2e-5240476925379Protein SCARECROW
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_81.126
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894499.10.0scarecrow-like protein 33
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLA0A2C9WLQ00.0A0A2C9WLQ0_MANES; Uncharacterized protein
STRINGevm.model.supercontig_81.1260.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]