PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_81.122
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family GRAS
Protein Properties Length: 691aa    MW: 78123.4 Da    PI: 6.3152
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_81.122genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS368.31e-1123116602353
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalk 82 
                                    +lL++cA++vss d++ a++lL+++++++s+ gd +qR+a+yf++AL+ r+a+  + +y+ + + +ts    +e l+a++
  evm.model.supercontig_81.122 311 STLLMQCAQCVSSFDQRTATELLKQIRQHSSQFGDGTQRMAFYFANALEVRMAGAKTPVYSPILSCKTS---AAEILQAYE 388
                                   579***************************************************999999999666666...79******* PP

                          GRAS  83 lfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleet 161
                                   +++ ++P+ k+s++ aN++I++ +e+++r+HiiDf+i +G+QWp+L+q L+sRp+gpp+lRiTg++ p++g   +e+++et
  evm.model.supercontig_81.122 389 VYVTACPFKKMSNFFANKTIVKLAEKATRLHIIDFGILYGFQWPCLIQRLSSRPNGPPNLRITGIELPQPGfrPAERVQET 469
                                   **********************************************************************9********** PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvv 242
                                   g+rL++++e+++vpfe+n+ +ak++e+++le+L+++++E+++Vn+ +++++++d+++ ++s rd+v+kl+k+++P+++v+ 
  evm.model.supercontig_81.122 470 GHRLKRYCERFNVPFEYNF-IAKKWETIKLEDLKIDRDETTVVNCLYRMKNIPDDTMVVNSSRDTVMKLIKEINPDLFVHG 549
                                   *******************.7************************************************************ PP

                          GRAS 243 eqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                                     +  +n++ F++rf eal ++s+lfd++ea++pre+++r++ Ere++gr+++nv+aceg+er+er et+++W+ r  ++G
  evm.model.supercontig_81.122 550 VVNGTYNAPFFVTRFREALFHFSSLFDMFEATVPREDQQRMMFEREVFGRDAMNVIACEGTERVERPETYKQWQVRNLRMG 630
                                   ********************************************************************************* PP

                          GRAS 324 Fkpvplsekaakqaklllrkvksdgyrvee 353
                                   F+++pl++++ k +k++++  +   + ++ 
  evm.model.supercontig_81.122 631 FRQLPLDHEILKRVKTMVKSSYHGDFVIDV 660
                                   *******************99955587765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.557284661IPR005202Transcription factor GRAS
PfamPF035143.5E-110311660IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MDTVLHVYPS SLNGFKMDPS SMSSCSNQIL VNGDRPSQGI VDLDSSSPES NPQASSIESL  60
SPSSSTSLDG DHPDNSHFAH VVLKYINEML MEEDLEGQPC MLQDCLAVQA AEKSFYEVIG  120
QKYPPSPDRL SPQSLYQSDN HPDDNILGSS SSDSCDGYIA ASNSMESHWM HSEGKLEASH  180
LQASFTDSPQ NFTSLPDLEN CDCMPFAPKS NLLRPPELGK RYQSPSGSRG RKSYQRDDGG  240
YLEEGRSSKQ SALSLTELEQ SEMFDQVLLC KGENEQIVSG SLHEKLQSNQ RSKGKTRTKR  300
QGKKREVVDL STLLMQCAQC VSSFDQRTAT ELLKQIRQHS SQFGDGTQRM AFYFANALEV  360
RMAGAKTPVY SPILSCKTSA AEILQAYEVY VTACPFKKMS NFFANKTIVK LAEKATRLHI  420
IDFGILYGFQ WPCLIQRLSS RPNGPPNLRI TGIELPQPGF RPAERVQETG HRLKRYCERF  480
NVPFEYNFIA KKWETIKLED LKIDRDETTV VNCLYRMKNI PDDTMVVNSS RDTVMKLIKE  540
INPDLFVHGV VNGTYNAPFF VTRFREALFH FSSLFDMFEA TVPREDQQRM MFEREVFGRD  600
AMNVIACEGT ERVERPETYK QWQVRNLRMG FRQLPLDHEI LKRVKTMVKS SYHGDFVIDV  660
DGRGGLRALQ LSLVCFGCLQ ESLLLFRDEC *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-463146388330GRAS family transcription factor containing protein, expressed
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_81.122
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021894472.10.0scarecrow-like protein 30
TrEMBLA0A061GVV60.0A0A061GVV6_THECC; GRAS family transcription factor, putative
STRINGevm.model.supercontig_81.1220.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35827189
Representative plantOGRP26615129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-178GRAS family protein