PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_80.88 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 188aa MW: 20878.5 Da PI: 9.207 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 138.3 | 2.2e-43 | 70 | 146 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 Cqve+C a+l+eak+yhrrhkvCe+h+kapvvlv+gl+qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk++a evm.model.supercontig_80.88 70 CQVEKCGANLAEAKRYHRRHKVCEIHAKAPVVLVAGLRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSAA 146 **************************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.2E-35 | 63 | 131 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.838 | 67 | 144 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.83E-39 | 68 | 148 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 4.0E-33 | 70 | 143 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MEARGLEGKL YSKEKAIKDC LVMEVDNDME DEEEIGSMGD GFGGDDEKKK KVSGKKGSGS 60 TSGSVSPPSC QVEKCGANLA EAKRYHRRHK VCEIHAKAPV VLVAGLRQRF CQQCSRFHEL 120 SEFDEAKRSC RRRLAGHNER RRKSAAETCS EGSSRKGVSP QCRQTDERDR IQINLPGTSS 180 FKRSQIR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-38 | 61 | 143 | 2 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_80.88 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156. {ECO:0000269|PubMed:16914499}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021894759.1 | 1e-134 | squamosa promoter-binding protein 1 | ||||
Swissprot | Q9S758 | 4e-54 | SPL5_ARATH; Squamosa promoter-binding-like protein 5 | ||||
TrEMBL | A0A1B3IL68 | 6e-72 | A0A1B3IL68_POPTO; Squamosa promoter-binding protein 20 | ||||
TrEMBL | A0A2K2CB25 | 2e-71 | A0A2K2CB25_POPTR; Uncharacterized protein | ||||
STRING | evm.model.supercontig_80.88 | 1e-134 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM868 | 28 | 118 | Representative plant | OGRP97 | 17 | 230 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G15270.1 | 1e-53 | squamosa promoter binding protein-like 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_80.88 |
Publications ? help Back to Top | |||
---|---|---|---|
|