PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_8.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family HB-other
Protein Properties Length: 1094aa    MW: 123428 Da    PI: 7.386
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_8.11genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox40.35.5e-13554857
                                -HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                    Homeobox  8 tkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                t+ ql++Le+++ +++yp++e+++  A+ lgLt +qV+ WF  rR ++k+
  evm.model.supercontig_8.11  5 TPLQLQTLEDFYTEENYPTQEAMQSYASALGLTSKQVRGWFIERRRRDKR 54
                                899*********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003892.9E-10159IPR001356Homeobox domain
PROSITE profilePS5007114.349155IPR001356Homeobox domain
SuperFamilySSF466897.7E-12355IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-13354IPR009057Homeodomain-like
CDDcd000866.53E-11356No hitNo description
PfamPF000462.6E-10454IPR001356Homeobox domain
PROSITE profilePS5082712.869319378IPR018501DDT domain
SMARTSM005711.4E-9319378IPR018501DDT domain
PfamPF027917.0E-10320373IPR018501DDT domain
PfamPF156124.0E-8598638IPR028942WHIM1 domain
PfamPF156131.3E-11731804IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1094 aa     Download sequence    Send to blast
MKRKTPLQLQ TLEDFYTEEN YPTQEAMQSY ASALGLTSKQ VRGWFIERRR RDKRDNETDR  60
SKTKTLSSRY ECTSTRKESS INKRAEKIIL QDLLTPGYIL KKLFRKDGPP LGVQFDSLPS  120
KVSKKSLLDC QDCNEKAAGN KHGMGKGLMT VWRAVNPNGG DPPPGFGWSS KQNTDLLQIS  180
TPILPKPPLR KKRPRQLASI LKQKRLENKL REKRKPPIKR REVGFDKDSL NLSCKEKCEL  240
ALDGEVRNFC QDQSAMLVDD EELEMRELRA GPNPLTCSDH LGASGLRGCS LCRDFLAKFP  300
PNNIKMKQPF GLQPWDSSPE TVKKLFKVFH FLYTYSLILG VCPFTLDEFA QAFHDKDSLL  360
LGKIHVALLK LLLLDVEMGL SSGIFPNLSV SCKFLALLHS VENQELILEF WKKSLNPLTW  420
IEILRQVLVA AGFGSKQGLR KECLSKEMNL MAKCGLRPGT LKGELFRSLS EQGSSGLNVS  480
DLAKHSKIAE LNLASSTEEL ERLICSTLSS DITLFEKISQ SAYRLRINSL ASEASDSQSD  540
DEDSGSVDDN SDDGGLLSNS SDSECDSETL SLSKPRRRSC RKSKNVLSVY TEIDESHPGE  600
AWLLGLMEGE YADLSIEEKL SALVALVDLL GAGLTLRTEE PRKAIIECIP SIHQRGSGAK  660
IKRLSSNQHN FPRPSWVHVG QIQSVKEAYP SSECHPIDSS SILKISGMQK SSSSGIFEKD  720
AEVVFDVHPM QSIFLGSDRR YNRYWLFLGP CNAYDPGHKR VYFESSEDGH WEVIDTEEAL  780
RTLLSVLDDR GAREALLIES LEKREAFLCQ AMSSSLINDA GVRQLPHSDS SELEVVREDS  840
SSPVSDIDNL SLNEVANNSL PPRGAIILEV GKRGEEQNRV WSRLQKFDAW IWEGFYLNLN  900
AVKHSKRSYL DSLARCESCH DLFWRDEKHC KICHTTFELD FDLEERYAVH AATCRKKGDN  960
TIFPKHKVLS SQLQSLKAAV HAIESVMPEE ALVGAWTKSA HRLWVKRLRR TSSFIRTSAD  1020
WLWQCNDDEG FGGMEEIIKS FQTMPQTSSA VAFWLVGTLL RHSFGAYRWD SPWERIALTD  1080
YFQLFRPCFH PDA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14651ERRRRD
24752RRRRDK
34754RRRRDKRD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator required for the maintenance of the plant vegetative phase. May prevent the early activation of the vegetative-to-reproductive transition by regulating key genes that contribute to flower timing. {ECO:0000250|UniProtKB:F4HY56}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapevm.model.supercontig_8.11
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165912e-38AC216591.1 Populus trichocarpa clone POP002-D23, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021907255.10.0LOW QUALITY PROTEIN: homeobox-DDT domain protein RLT3
SwissprotF4JRF50.0RLT3_ARATH; Homeobox-DDT domain protein RLT3
TrEMBLA0A061DLH80.0A0A061DLH8_THECC; Homeodomain-like transcriptional regulator isoform 1
STRINGevm.model.supercontig_8.110.0(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM96382125
Representative plantOGRP916177
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12750.10.0Homeodomain-like transcriptional regulator