Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | GRAS | 421.1 | 9.2e-129 | 155 | 521 | 1 | 374 |
GRAS 1 lvelLlecAeavssgdlelaqalLarlsel..aspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80
lv+ L++cAe v+ g+l la +l++ ++ l ++g + ++a yf AL++r+++ ++l+ +++ s+ + +
evm.model.supercontig_75.88 155 LVHMLMTCAESVQRGELPLAGSLIEDMRGLlaHVNQGCGIGKVAGYFIDALNRRILSPPQSLAVSVNGSAFE------NEIL 230
689*************************9987778899*******************666666555555554......4556 PP
GRAS 81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
++ f+e++P+lkf+h+taNqaIlea++g+++vH++Df++++GlQWpaL+qaLa Rp+gpp lR+Tg+g+p+++ +++l+e+g
evm.model.supercontig_75.88 231 YHHFYEACPYLKFAHFTANQAILEAFDGHDCVHVVDFNLMHGLQWPALIQALALRPGGPPLLRLTGIGPPSPDGRDSLREIG 312
789******************************************************************************* PP
GRAS 163 erLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveq 244
rLa++A++++v+f f+ ++a+rled+++++L+v+p+EalaVn+++qlhrll +++ +s+++ vL +++l+Pk+++vveq
evm.model.supercontig_75.88 313 LRLAELARSVNVRFAFRGVAASRLEDVKPWMLQVSPKEALAVNSIMQLHRLLGADQNRNSPIEMVLGWIRNLNPKIMTVVEQ 394
********************************************************************************** PP
GRAS 245 eadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkp 326
ea+hn+++F++rf+eal+yys++fdslea + + e+++ E + ++rei+nv++ceg++r erhe lekWr+rl++aGFkp
evm.model.supercontig_75.88 395 EASHNQPDFFDRFTEALYYYSTMFDSLEAC--AMQPEKAFAEIH-IQREICNVLCCEGSARLERHEPLEKWRSRLGRAGFKP 473
***************************999..466777777777.************************************* PP
GRAS 327 vplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
+ l+++a kqa++ll ++ dgy vee++g+l+lgW++rpL+++SaW+
evm.model.supercontig_75.88 474 LYLGSNAFKQASMLLTLFSADGYCVEENEGCLTLGWHSRPLIAASAWQ 521
***********************************************6 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Probably acts by participating in large multiprotein complexes that represses transcription of GA-inducible genes. Upon GA application, it is degraded by the proteasome, allowing the GA signaling pathway (By similarity). {ECO:0000250}. |
UniProt | Transcriptional regulator that acts as a repressor of the gibberellin (GA) signaling pathway. Transcription coactivator of the zinc finger transcription factors GAF1/IDD2 and ENY/IDD1 in regulation of gibberellin homeostasis and signaling (PubMed:25035403). No effect of the BOI proteins on its stability. Probably acts by participating in large multiprotein complexes that repress transcription of GA-inducible genes. Positively regulates XERICO expression. In contrast to RGA, it is less sensitive to GA. Its activity is probably regulated by other phytohormones such as auxin and ethylene. {ECO:0000269|PubMed:11487693, ECO:0000269|PubMed:11606551, ECO:0000269|PubMed:11606552, ECO:0000269|PubMed:14973286, ECO:0000269|PubMed:15128937, ECO:0000269|PubMed:16034591, ECO:0000269|PubMed:17933900, ECO:0000269|PubMed:25035403, ECO:0000269|PubMed:9389651}. |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] - Gallego-Giraldo C, et al.
Role of the gibberellin receptors GID1 during fruit-set in Arabidopsis. Plant J., 2014. 79(6): p. 1020-1032 [PMID:24961590] - Fukazawa J, et al.
DELLAs function as coactivators of GAI-ASSOCIATED FACTOR1 in regulation of gibberellin homeostasis and signaling in Arabidopsis. Plant Cell, 2014. 26(7): p. 2920-38 [PMID:25035403] - MarĂn-de la Rosa N, et al.
Genome Wide Binding Site Analysis Reveals Transcriptional Coactivation of Cytokinin-Responsive Genes by DELLA Proteins. PLoS Genet., 2015. 11(7): p. e1005337 [PMID:26134422] - Shi H,Wei Y,Wang Q,Reiter RJ,He C
Melatonin mediates the stabilization of DELLA proteins to repress the floral transition in Arabidopsis. J. Pineal Res., 2016. 60(3): p. 373-9 [PMID:26887824] - Lee SA, et al.
Interplay between ABA and GA Modulates the Timing of Asymmetric Cell Divisions in the Arabidopsis Root Ground Tissue. Mol Plant, 2016. 9(6): p. 870-84 [PMID:26970019] - Qu J,Kang SG,Hah C,Jang JC
Molecular and cellular characterization of GA-Stimulated Transcripts GASA4 and GASA6 in Arabidopsis thaliana. Plant Sci., 2016. 246: p. 1-10 [PMID:26993231] - Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S
JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] - Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S
Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] - Wang H, et al.
The DELLA-CONSTANS Transcription Factor Cascade Integrates Gibberellic Acid and Photoperiod Signaling to Regulate Flowering. Plant Physiol., 2016. 172(1): p. 479-88 [PMID:27406167] - Li W,Wang H,Yu D
Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions. Mol Plant, 2016. 9(11): p. 1492-1503 [PMID:27592586] - Liu B,De Storme N,Geelen D
Gibberellin Induces Diploid Pollen Formation by Interfering with Meiotic Cytokinesis. Plant Physiol., 2017. 173(1): p. 338-353 [PMID:27621423] - Matsuoka K, et al.
Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls. Plant Cell Physiol., 2016. 57(12): p. 2620-2631 [PMID:27986917] - Zentella R, et al.
The Arabidopsis O-fucosyltransferase SPINDLY activates nuclear growth repressor DELLA. Nat. Chem. Biol., 2017. 13(5): p. 479-485 [PMID:28244988] - Zhang Y, et al.
GA-DELLA pathway is involved in regulation of nitrogen deficiency-induced anthocyanin accumulation. Plant Cell Rep., 2017. 36(4): p. 557-569 [PMID:28275852] - Zhang L,Chen L,Yu D
Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369] - Nelson SK,Ariizumi T,Steber CM
Biology in the Dry Seed: Transcriptome Changes Associated with Dry Seed Dormancy and Dormancy Loss in the Arabidopsis GA-Insensitive sleepy1-2 Mutant. Front Plant Sci, 2017. 8: p. 2158 [PMID:29312402] - Liu B,De Storme N,Geelen D
Cold-Induced Male Meiotic Restitution in Arabidopsis thaliana Is Not Mediated by GA-DELLA Signaling. Front Plant Sci, 2018. 9: p. 91 [PMID:29459879] - Zhang Y, et al.
DELLA proteins negatively regulate dark-induced senescence and chlorophyll degradation in Arabidopsis through interaction with the transcription factor WRKY6. Plant Cell Rep., 2018. 37(7): p. 981-992 [PMID:29574486] - Felipo-Benavent A, et al.
Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856] - Wright DA, et al.
Recovery of YAC-end sequences through complementation of an Escherichia coli pyrF mutation. Nucleic Acids Res., 1997. 25(13): p. 2679-80 [PMID:9185581]
|