PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | evm.model.supercontig_73.54 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 175aa MW: 19458.3 Da PI: 6.6344 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41 | 4.6e-13 | 113 | 153 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W ++E+ ll++++ ++G g+W+ +a+++g +++ qc+++++ evm.model.supercontig_73.54 113 WNADEEILLLEGIDMYGFGNWAEVAEHVG-TKSKSQCIDHYN 153 *****************************.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00291 | 3.1E-10 | 49 | 94 | IPR000433 | Zinc finger, ZZ-type |
PROSITE profile | PS50135 | 10.925 | 53 | 96 | IPR000433 | Zinc finger, ZZ-type |
Pfam | PF00569 | 3.3E-10 | 53 | 91 | IPR000433 | Zinc finger, ZZ-type |
SuperFamily | SSF57850 | 5.06E-15 | 53 | 116 | No hit | No description |
CDD | cd02335 | 1.00E-23 | 53 | 101 | No hit | No description |
PROSITE pattern | PS01357 | 0 | 55 | 82 | IPR000433 | Zinc finger, ZZ-type |
SuperFamily | SSF46689 | 2.99E-13 | 105 | 159 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 21.487 | 108 | 160 | IPR017884 | SANT domain |
SMART | SM00717 | 1.6E-11 | 109 | 158 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 4.8E-13 | 112 | 153 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.0E-9 | 113 | 154 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.01E-13 | 113 | 153 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 175 aa Download sequence Send to blast |
MKSCLPVLVL SVMKSLFSWS SRPKRKKNSS NSDNIENAAF PGQATSEGKG ALYHCNYCNK 60 DITSVVRVKC AVCPDFDLCV ECFSVGAEVT PHKCNHPYRI MDNLSFPLIC PDWNADEEIL 120 LLEGIDMYGF GNWAEVAEHV GTKSKSQCID HYNAVYMNSP CFPLPVRLVK DQNI* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6cw3_E | 3e-38 | 53 | 165 | 5 | 117 | Transcriptional adapter 2 |
6cw3_G | 3e-38 | 53 | 165 | 5 | 117 | Transcriptional adapter 2 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | evm.model.supercontig_73.54 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021895411.1 | 1e-119 | transcriptional adapter ADA2-like | ||||
Swissprot | Q75LL6 | 5e-73 | TADA2_ORYSJ; Transcriptional adapter ADA2 | ||||
TrEMBL | A0A0D2UXF3 | 8e-85 | A0A0D2UXF3_GOSRA; Transcriptional adapter | ||||
TrEMBL | A0A2P5W492 | 4e-86 | A0A2P5W492_GOSBA; Uncharacterized protein | ||||
TrEMBL | A0A2P5X7M7 | 1e-84 | A0A2P5X7M7_GOSBA; Transcriptional adapter | ||||
STRING | evm.model.supercontig_73.54 | 1e-128 | (Carica papaya) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM21599 | 2 | 2 | Representative plant | OGRP2480 | 9 | 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | evm.model.supercontig_73.54 |
Publications ? help Back to Top | |||
---|---|---|---|
|